KEGG   Rhodococcus fascians: A3L23_03391Help
Entry
A3L23_03391       CDS       T04328                                 

Gene name
gutB_6
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A3L23_03391 (gutB_6)
Enzymes [BR:rfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A3L23_03391 (gutB_6)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A3L23_03391 (gutB_6)
    1.1.1.-  
     A3L23_03391 (gutB_6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 Adhesin_Dr NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AMY54716
UniProt: A0A165MD33
Position
3502567..3503640
Genome map
AA seq 357 aa AA seqDB search
MRAALFHDRHDVRVEDVPAPKVGPGEVLLRPFFCGICGTDLHEYAFGPIVIPTEPHALTG
AKAPQVFGHEFSARVVEIGSDVESVAVGNRVSVMPLVTCGKCYYCRRGLNHLCVIMACTG
LSWGGGGISELVAVQEQQVSVLPDSVSDVQGALIEPAAVAAYGVDCTGMRAGDTILITGA
GPIGALSALYAHASGAAKIIVSEPNAKRRTLIEAFGIAEVLDPTVQDVPAAVRALTGGIG
VDAAAECSGHQHGLTAALDSVRSGGTVAQVGLHVKPATIDPMAMSNKDLTLVGTWCYPVY
DWPRIIALVASGRYPVEKVVSEIIDVENIVADGFERLLDPNGDAQKLLVRVGDAPTS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctgcgttatttcacgaccgacacgatgtacgggtagaagacgttccggccccg
aaggtcggcccgggcgaggttctgcttcgaccgttcttctgcggcatctgcggaacggac
ctgcacgagtacgccttcggtccgatcgtcattccgaccgaaccccacgcactcaccggt
gcgaaagcgccgcaggtgttcggacacgaattctcggcgcgcgtagtcgagatcggctcc
gacgtcgagtcggtcgcagtgggcaatcgcgtgtcggtcatgccgctcgtcacctgcggt
aagtgctactactgccgacgcggactgaaccacctgtgtgtgatcatggcctgcaccggt
ctgagctggggcggcggaggaatttcagaactggttgcggtgcaggaacaacaggtgtcg
gtgctaccagacagtgtcagtgacgtccagggcgcgctgatcgagccggcagcggtggcc
gcctacggcgtcgactgcaccgggatgcgcgccggggacaccattctcatcaccggagcg
ggaccgatcggtgccctgtccgctctgtacgcacatgcgtcgggcgcggcaaagatcatc
gtctcggagccgaatgccaagcgccgcacgctgatcgaggcattcggtatcgcagaagta
ctggatccgacggtgcaggatgtccctgccgccgtccgcgccctcaccggcggcatcgga
gtcgacgccgcagcggaatgctcgggtcaccagcacggactgacggccgcactcgacagc
gtccgctccggaggaaccgtcgcgcaggtcggtctgcacgtcaagcccgcgacgatcgat
cccatggccatgtccaacaaggacctgacactggtgggtacctggtgctacccggtgtac
gactggccgcgcatcatcgcgctggtcgcgtcgggacgctacccggtggagaaggtcgtc
agcgaaatcatcgacgtcgagaacatcgtcgccgacggattcgagcggctgctggatccg
aacggtgacgcgcagaagcttttggtgcgagtcggcgacgcaccgacgtcctga

DBGET integrated database retrieval system