KEGG   Rhodococcus fascians: A3L23_03568Help
Entry
A3L23_03568       CDS       T04328                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00071  Fatty acid degradation
rfa00072  Synthesis and degradation of ketone bodies
rfa00280  Valine, leucine and isoleucine degradation
rfa00310  Lysine degradation
rfa00362  Benzoate degradation
rfa00380  Tryptophan metabolism
rfa00620  Pyruvate metabolism
rfa00630  Glyoxylate and dicarboxylate metabolism
rfa00640  Propanoate metabolism
rfa00650  Butanoate metabolism
rfa00900  Terpenoid backbone biosynthesis
rfa01100  Metabolic pathways
rfa01110  Biosynthesis of secondary metabolites
rfa01120  Microbial metabolism in diverse environments
rfa01130  Biosynthesis of antibiotics
rfa01200  Carbon metabolism
rfa01212  Fatty acid metabolism
rfa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rfa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3L23_03568
   00630 Glyoxylate and dicarboxylate metabolism
    A3L23_03568
   00640 Propanoate metabolism
    A3L23_03568
   00650 Butanoate metabolism
    A3L23_03568
  Lipid metabolism
   00071 Fatty acid degradation
    A3L23_03568
   00072 Synthesis and degradation of ketone bodies
    A3L23_03568
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3L23_03568
   00310 Lysine degradation
    A3L23_03568
   00380 Tryptophan metabolism
    A3L23_03568
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A3L23_03568
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3L23_03568
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A3L23_03568
Enzymes [BR:rfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A3L23_03568
Exosome [BR:rfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3L23_03568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AMY54890
UniProt: A0A165MGN8
Position
3723513..3724703
Genome map
AA seq 396 aa AA seqDB search
MTTTVIVAGARTPVGRFSGALKDFSGSDLGGIAIKGALEKAGVAPDQVDYVIMGQVLTAG
AGQIPARQAAVAAGIPMTVPALTINKVCLSGVDAIALADQLIRAGEFEIVVAGGQESMTQ
APHMLEKSRAGFKYGDVTMRDHLAYDGLYDIFTDQAMGALTEQRNQSSEAISREEQDTFA
AASHQKAAAAWKNGVFDDEVVPVSIPQRKGEPIQFTADEGIRADTTVDSLGKLRPAFDKA
GTVTAGSASQISDGAAAVVVMSKDKAESLGLTWLAEIGAHGVVAGPDSTLQSQPARAIAK
ACAKEGIDPKDLDVVEINEAFAAVGIASTRELGIDPEIVNVNGGAISIGHPLGMSGARIA
LHLALELQRRGGGVGAAALCGGGGQGDALIVRVPKS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacaacagtcatcgtcgccggtgctcgtacgcccgtcgggcgcttctcgggtgcg
ctcaaggacttctcgggttccgacctcggcggaattgccatcaagggcgcactcgaaaag
gccggcgtcgctccggatcaggtcgactacgtcatcatgggccaggtccttactgcgggt
gccgggcagatcccggcgcgtcaggccgccgtcgctgcaggtatcccgatgaccgttccg
gccctgaccatcaacaaggtgtgtctctccggcgtcgacgccatcgcgctcgctgatcag
ctcattcgcgcgggggagttcgagatcgtcgtcgccggtggccaggaatcgatgacccag
gcaccgcacatgctggagaagtcgcgggcgggattcaagtacggcgatgtcaccatgcgc
gaccacctcgcatacgacggcttgtacgacatcttcaccgatcaggccatgggtgcgctc
accgagcagcgcaatcagagctcggaggcgatcagccgtgaggagcaggacaccttcgcg
gccgcatcgcatcagaaggctgccgcggcgtggaagaacggggttttcgacgacgaggta
gtgcccgtgtcgattccccagcgcaagggtgagcccatccagttcactgccgacgaagga
atccgggccgacaccacggtcgattccctcggtaagcttcgccccgcgttcgacaaggcg
ggcacggtcacggccggatccgcgtcgcagatttccgacggtgccgctgccgtcgtcgtg
atgagcaaggacaaggccgagtcgctcggtttgacctggctcgccgagatcggcgcgcac
ggtgtggtggccggccccgactccaccctgcagtcgcagcccgctcgcgccatcgccaag
gcctgcgcgaaggaaggcatcgacccgaaggacctcgacgtcgtcgagatcaacgaggcg
ttcgcggcggtcggaatcgcgtcgacgcgtgagctcggcatcgatccggagatcgtcaac
gtcaacggcggtgcgatttcgatcggtcatcccctcggaatgtcgggcgcacgcatcgca
ctgcacctggctctcgagctgcagcggcgcggtggcggagtgggtgccgcagcattgtgc
ggcggcggcggacagggcgacgcgctcatcgttcgagtcccgaaaagctga

DBGET integrated database retrieval system