KEGG   Rhodococcus fascians: A3L23_04368Help
Entry
A3L23_04368       CDS       T04328                                 

Gene name
coaBC
Definition
(GenBank) Coenzyme A biosynthesis bifunctional protein CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00770  Pantothenate and CoA biosynthesis
rfa01100  Metabolic pathways
Module
rfa_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:rfa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A3L23_04368 (coaBC)
Enzymes [BR:rfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     A3L23_04368 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     A3L23_04368 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein YjeF_N SpoU_sub_bind
Motif
Other DBs
NCBI-ProteinID: AMY55675
UniProt: A0A165MXN2
Position
complement(4620702..4621955)
Genome map
AA seq 417 aa AA seqDB search
MHVVVGVGGGIAAYKSCALIRKFTENGHQVRVIPTASALEFVGRATFEALSGQPVHTGVF
ADVPEVPHVRLGQEADLVVVAPATADLMARIAGGRADDLLTATLLTARCPVVLAPAMHTE
MWEHPATVANVTTLRSRGTQVIEPASGRLTGRDTGSGRLPEPEEIFALAMLLTERADAMP
RDLEGRRILISAGGTREPLDPVRFLGNRSSGKQGYALARVAAQRGAHVTLIAGYTSDLEA
PAAVDVVHVKTASDMQDAVRSHATDVDAVVMAAAVADFRPESIASSKIKKGSNEPSSIPL
VRNDDILAGLVSARHSGDVRSSTVIVGFAAETGDADGDVLTYARAKLERKGCDLLVVNAV
GDGKAFEVDHNDGWLLGSDGSEAALGEGSKALLASRVLDSVAQMLRSRDTRPTSDTR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgtggtcgtcggagtaggcggcggtatcgccgcctacaagagttgtgcgctcatt
cgaaaattcaccgagaacggccatcaggttcgagtgattccgactgcgtcggcgctcgaa
ttcgtcggccgcgcaacattcgaggcattgtccggccagccggtgcacaccggcgtgttc
gccgatgtgcccgaggtgccgcacgttcggctggggcaggaagcggatctcgtcgtcgtc
gcgccggccaccgcggacctgatggctcgaatcgcgggcgggcgggcggacgatctgctc
accgcgacgttgctgaccgctcggtgccccgtcgtgttggccccggccatgcacacggag
atgtgggaacacccggccactgttgcgaacgtcaccacgctccgatcgcgcggtacccag
gtgatcgagcctgcgtccggccggttgaccggacgcgacaccggttcgggccgactgccc
gagcccgaggagatcttcgctctcgccatgctgctgaccgaacgtgcggacgcgatgccg
cgcgatctcgagggacggcgaattctgatctcggccggtggtacgcgggaacccctcgat
cccgttcgttttctggggaatcggagttccggcaagcaggggtacgcgttggctcgagtc
gctgcccagcgcggtgcccacgtgaccttgatcgccgggtacaccagcgacctcgaggca
cccgcggcggtcgatgtggtccacgtgaagaccgcgtccgatatgcaggacgcggtgcgc
tcgcatgcgaccgacgtcgacgcagtggtgatggcggctgcggtcgccgacttcagaccc
gagtccatcgcgagcagcaagatcaagaagggctcgaacgaaccgtcgtcgattcctctg
gtccgcaacgacgacatcctcgccggtctcgtgtcggctcggcacagcggagacgtccga
tcgtcgacggtgatcgtcggattcgccgccgagacgggcgacgccgacggtgacgtgctc
acctacgcgcgagccaagctcgaacgcaaaggctgcgatctgctcgtcgtcaatgcggtg
ggagacggcaaggccttcgaggtcgaccacaacgacggctggttgttgggatccgacggc
tccgaggccgcgctgggggagggctcgaaagctctgctcgccagcagggtgttggattcg
gtcgcccagatgcttcgctcccgcgatacgcggcccacttcggatacccgctga

DBGET integrated database retrieval system