KEGG   Rickettsia felis: RF_0079Help
Entry
RF_0079           CDS       T00252                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rfe  Rickettsia felis
Pathway
rfe00473  D-Alanine metabolism
rfe01100  Metabolic pathways
rfe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rfe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RF_0079 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    RF_0079 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rfe01011]
    RF_0079 (alr)
Enzymes [BR:rfe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RF_0079 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:rfe01011]
 Precursor biosynthesis
  Racemase
   RF_0079 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Yop-YscD_ppl
Motif
Other DBs
NCBI-ProteinID: AAY60930
UniProt: Q4UNC8
Position
85356..86744
Genome map
AA seq 462 aa AA seqDB search
MSLCTLEINLSAIKNNYLLLQDICKTSLVGAAVKANGYGLGAVQISKALIEENCRHFFVA
SSEEGVNLRKALASWHESVFRHCEKNYTVIRRSNPVKNSVSQNFFNYFSGLQQCFAPRND
GSSIHATTPKALDNDVNILVLNGVFEHDALELIEYNLTPVLNNLKQIEIWQKFSNLKNRL
LPCYLHFNTGINRLGLTHNEIEQLINNRDLLKGLDLQYIISHLAVSEEIDNPYNLEQLNR
FKTYLQYFPNVKASLANSGGIFLGQDYHFDLARPGAALYGLNPVIDLSNNLSYKEEFEGD
TERRTAAYINVREDSSTGSTYKLPLEGGYSRGLQNPVTLKAPIIHLQNLTLDSHIGYNMT
FTTERDSVIATLPLGYADGFSRNFSNQGEVFINGRSVPIVGRISMDLINIDVTDLPPLDI
FLGQEAEIIGNYCTPDKIASIIGTIGYEVLTSLGSRYKRIYK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgtgtactctagaaataaatctatctgcaataaaaaataattatcttttatta
caagatatttgcaaaacctcattagtcggtgctgccgttaaagctaacggttacggtctt
ggagcagtgcaaatttccaaagctttaatagaagaaaattgtaggcatttttttgtggcc
tcaagtgaagaaggagtgaatttacgcaaagctctagcttcgtggcatgaatcggttttc
cgtcattgcgagaagaattacacagtaattcgacgaagcaatccagtaaaaaattctgta
agtcagaatttttttaattatttttctggattgcaacaatgcttcgctcctcgcaatgac
ggctctagtatccatgcaacaacgcccaaagcactagataatgatgttaatattttagtt
ctcaatggagtttttgaacatgatgctttagagcttatagaatataatttaactcctgtt
ctaaataacttaaaacaaatagaaatttggcaaaaatttagtaatttgaaaaaccgatta
ttgccttgttatttacatttcaatacggggattaatcgccttggattaactcataatgaa
atagagcagttaattaataatcgtgatttattaaaagggctagatttacaatatattata
agccatctagctgtatccgaggaaatagataatccttataatctagagcaattaaacaga
tttaaaacttatttacaatatttcccaaacgtcaaagcaagccttgctaattccggtggc
atatttttaggacaggactatcattttgatttagcaagaccaggggctgccttatacggg
cttaatcctgtaatagacctctcgaataacctatcttataaagaggaatttgaaggagac
acggaacgcagaaccgcagcgtacataaacgtacgtgaggattcgagtaccggatcgacg
tataaattacctttagaaggaggttattcgagaggtctacaaaatcccgtaaccttaaaa
gctcctataattcatttacagaatttgacactagatagccatatcggttataatatgact
tttacaactgagcgtgatagtgttattgcaacattaccgcttggttatgccgatgggttt
agtcgtaattttagcaatcaaggcgaagtatttattaatggtcgcagcgttcctatagta
gggcgaatatcgatggatttgataaatatcgatgttaccgatctaccaccgcttgatatt
tttctagggcaggaagcggaaattatcggaaattattgcacgcccgataaaatagcaagt
attataggtactatagggtatgaggtgttgactagtctcggtagtaggtataaaagaatt
tataagtaa

DBGET integrated database retrieval system