KEGG   Rickettsia felis: RF_0120Help
Entry
RF_0120           CDS       T00252                                 

Gene name
ndk
Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
rfe  Rickettsia felis
Pathway
rfe00230  Purine metabolism
rfe00240  Pyrimidine metabolism
rfe01100  Metabolic pathways
rfe01110  Biosynthesis of secondary metabolites
Module
rfe_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rfe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RF_0120 (ndk)
   00240 Pyrimidine metabolism
    RF_0120 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rfe04131]
    RF_0120 (ndk)
Enzymes [BR:rfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     RF_0120 (ndk)
Membrane trafficking [BR:rfe04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    RF_0120 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK DUF4708
Motif
Other DBs
NCBI-ProteinID: AAY60971
UniProt: Q4UN87
Position
complement(137677..138099)
Genome map
AA seq 140 aa AA seqDB search
MTIQYTFSMIKPDAIKRNKIGQVNTYLENAGLKIVAQKMKFLTKYEAECFYDEHRARPFF
NSLVEYITSGAVVLQVLKGEDAIILNRTIMGATNPAEAEAGTIRKDLGESIEANSIHGSD
SENSAKREIEFFFNKSEIIE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgacaatacaatatactttttcaatgattaagcctgatgctatcaagaggaataaaata
ggacaagttaatacttatttggaaaatgcaggcttaaagatagtagctcagaaaatgaaa
tttttaactaaatatgaagctgagtgtttctatgatgaacatagagcaagaccgtttttt
aatagcttagttgaatacattacttcaggagcggtagtacttcaagttcttaagggggaa
gatgctataattttaaaccgtaccattatgggtgcaactaatcctgctgaagctgaagcg
ggaactattagaaaagatttaggcgaatcaattgaggctaatagtattcatggttcagat
agtgaaaacagtgcgaaaagagaaatcgaatttttctttaacaaatctgaaattatagaa
taa

DBGET integrated database retrieval system