KEGG   Rickettsia felis: RF_0163Help
Entry
RF_0163           CDS       T00252                                 

Gene name
paaJ
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rfe  Rickettsia felis
Pathway
rfe00071  Fatty acid degradation
rfe00072  Synthesis and degradation of ketone bodies
rfe00280  Valine, leucine and isoleucine degradation
rfe00310  Lysine degradation
rfe00362  Benzoate degradation
rfe00380  Tryptophan metabolism
rfe00620  Pyruvate metabolism
rfe00630  Glyoxylate and dicarboxylate metabolism
rfe00640  Propanoate metabolism
rfe00650  Butanoate metabolism
rfe00900  Terpenoid backbone biosynthesis
rfe01100  Metabolic pathways
rfe01110  Biosynthesis of secondary metabolites
rfe01120  Microbial metabolism in diverse environments
rfe01130  Biosynthesis of antibiotics
rfe01200  Carbon metabolism
rfe01212  Fatty acid metabolism
rfe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RF_0163 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    RF_0163 (paaJ)
   00640 Propanoate metabolism
    RF_0163 (paaJ)
   00650 Butanoate metabolism
    RF_0163 (paaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RF_0163 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    RF_0163 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RF_0163 (paaJ)
   00310 Lysine degradation
    RF_0163 (paaJ)
   00380 Tryptophan metabolism
    RF_0163 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RF_0163 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RF_0163 (paaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RF_0163 (paaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rfe04147]
    RF_0163 (paaJ)
Enzymes [BR:rfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RF_0163 (paaJ)
Exosome [BR:rfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RF_0163 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAY61014
UniProt: Q4UN44
Position
179335..180513
Genome map
AA seq 392 aa AA seqDB search
MTKPVYITHAKRTAFGSFMGSLSTTAAPMLAAHLIKDILQNSKIDPALVNEIILGQVITG
GSGQNPARQTLIHAGIPKEVPGYTINKVCGSGLKSVALAANSIMIGDNEIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQEQDEFAL
SSHKKAAKAQLAGIFKDEILPIEVTIKKTTSLFEHDETVRPDTSLEILSKLRPAFDKNGV
VTAGNASSINDGAACLMVVSEEALKKHNLMPLARIVSYASAGVDPSIMGTAPVPASQKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDMDKVNINGGAIAIGHPIGASGGRVLIT
LIHSLRRAKAKKGLVTLCIGGGMGMAMCVESV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccggtttatataactcatgcgaaaaggacggctttcggctcgtttatgggt
agccttagtacaacagctgcacctatgcttgccgctcatttaataaaggatatactgcaa
aatagcaaaatcgatcctgctttggtaaatgagataatacttggacaagtaataacaggc
ggtagcgggcagaatccggcaaggcaaactctgattcatgcggggataccgaaagaagtg
cctggctatacgattaataaagtatgcggctcaggtcttaaaagcgtagcacttgcagca
aattcgattatgatcggtgataatgaaatagttatagcaggtgggcaggagaatatgtcg
ctcggtatgcacggtagctatatcagagcaggagctaaattcggtgatattaaaatggtt
gatctaatgcagtatgacggactaactgatgtattttcaggagtatttatgggaattact
gccgaaaatatctcgaaacagtttaatattagcagacaagagcaggacgaatttgcctta
agctctcataaaaaagcagctaaagcacaactagcaggaatttttaaagatgaaatctta
cctattgaagtgacgattaaaaaaactactagtttgtttgaacatgatgaaacggtaaga
cctgataccagccttgaaatcttaagtaaattacgtcctgcttttgataaaaacggtgta
gttactgctggtaatgcttcctcaattaatgacggtgcggcatgtcttatggtagtttcc
gaagaagctttgaaaaagcataatttgatgccgctagctcggattgtttcttatgcttca
gccggtgttgatccaagtattatgggtactgcccccgttcctgcctcccaaaaggcttta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcgtttgct
gctcaaagtatttatgtaaaccgtgaaatgaaatgggatatggataaggttaacataaat
ggcggtgcaatagcaatcgggcatccgatcggggcaagcggcggacgtgttcttattact
ttaatacacagcttgcgaagagctaaagctaaaaaaggcttggtcactttatgtatcggc
ggcggtatgggtatggctatgtgtgttgaatcggtttaa

DBGET integrated database retrieval system