KEGG   Reinekea forsetii: REIFOR_01052Help
Entry
REIFOR_01052      CDS       T05208                                 

Gene name
rlmM
Definition
(GenBank) LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
rfo  Reinekea forsetii
Brite
KEGG Orthology (KO) [BR:rfo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rfo03009]
    REIFOR_01052 (rlmM)
Enzymes [BR:rfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     REIFOR_01052 (rlmM)
Ribosome biogenesis [BR:rfo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    REIFOR_01052 (rlmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: ATX76205
UniProt: A0A2K8KN10
Position
1124384..1125457
Genome map
AA seq 357 aa AA seqDB search
MTALLLYCRPGFEKECLAEITYMAGEKGYFGWSNLLINSGFVIFETENAAEVYPLWQKSV
FCREAWPIHHRLEDLDPSDRLGPIQQAVTSLVSETGVRLFGNVSCEYAEGDDFHSTSRFA
GKFVHPVRQALRNQGLLSKKEDPSLPTLRLFFKDSAQVLVGLDEPRLRAPWPMGIARLRF
PSAAPSRSTLKLEEAFAAFLGPEWRALLADCRTGVDLGAAPGGWTWQLVKQELYVYAVDN
GSMDKTLMASGLVEHVLADGFTWKPFKMVDWLVCDMVEKPARVARLMYDWLDGRHAKYAI
FNLKLPMKKRFHEWQEIKAQLDSLIAENHPKAVFKARQLYHDREEITVMLDLRNQNG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgactgcattactgctttattgccgaccgggtttcgaaaaagaatgtctggcggaaatc
acctacatggccggcgaaaagggttatttcggctggtctaatctgctgattaattccggc
tttgtaatcttcgaaactgaaaacgccgcagaggtttacccgctctggcagaagtcggtc
ttttgtcgtgaagcctggcccatccatcatcgtttagaggatctggatccgagcgatcgc
ttggggccgattcagcaagcggtcaccagtctggtcagcgagacgggtgtgcgcctgttt
ggcaatgtatcgtgtgaatacgctgagggtgacgattttcactcgacctcccgctttgcc
ggcaagtttgtccacccggttcgacaggccttgcgcaaccaggggctgttgagcaaaaaa
gaagacccgagcttgccgacactacggctattctttaaagattccgcccaggtcctggtt
ggtctcgatgagccgcgtttgcgcgcaccctggcccatgggcatcgcccgactcagattc
cccagtgccgctccgagtcgcagcaccctcaagcttgaggaggcctttgcggcctttctc
ggcccggaatggcgagcgctcttggctgattgccgtaccggggtcgatctgggcgctgcg
ccgggcggctggacctggcaattggttaagcaggagctctatgtctacgccgtcgataac
ggctcgatggacaaaaccctaatggcctcaggcctggttgagcatgtgctggccgacggc
tttacgtggaagccgtttaagatggtcgactggttggtctgtgatatggtcgaaaagccg
gcccgagtggctcggctgatgtacgattggttggatggacggcatgccaaatatgccatc
tttaatcttaaattaccgatgaaaaaacgctttcatgagtggcaggaaattaaggctcag
ctcgacagcctgatcgccgaaaatcaccctaaagcggtttttaaagcgcgccagctgtat
catgaccgagaggaaattaccgttatgttggatctaaggaatcaaaacggatga

DBGET integrated database retrieval system