KEGG   Reinekea forsetii: REIFOR_01383Help
Entry
REIFOR_01383      CDS       T05208                                 

Definition
(GenBank) (S)-2-haloacid dehalogenase I
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rfo  Reinekea forsetii
Pathway
rfo00361  Chlorocyclohexane and chlorobenzene degradation
rfo00625  Chloroalkane and chloroalkene degradation
rfo01100  Metabolic pathways
rfo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rfo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    REIFOR_01383
   00361 Chlorocyclohexane and chlorobenzene degradation
    REIFOR_01383
Enzymes [BR:rfo01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     REIFOR_01383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6 NIT
Motif
Other DBs
NCBI-ProteinID: ATX76529
UniProt: A0A2K8KR42
Position
1491822..1492607
Genome map
AA seq 261 aa AA seqDB search
MAGLQAFYLDPSAIGVQAIGEPTMGRHIVRLIVLLKENPMSVTLAFDVYGTLIDTQGIVS
SLEKMIGTQASEFSRSWREKQLEYSFRRGLMQNYAPFSVCTSNALDFTCSYLKVSLTQAQ
KTELLKNYRTLPAFADVIESLSQLKAAGYRLFAFSNGSTDAVEELLVNAGIRTYFDGVVS
VEDIRSFKPNPGVYSYFLRQSGALGSAAWLISSNPFDVIGAISAGLQSAWVQRSQDAIFD
PWGIEPTATVASLNELNDVLA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccggccttcaggcgttttaccttgatccttcggccatcggagttcaagccattggt
gaaccaaccatgggtcgccatattgttaggctaatagtacttttaaaggaaaaccctatg
tcagtcacacttgcttttgatgtttacggaactttgattgatacccagggcatagtgtcg
tccctagagaaaatgatcggcacacaggcgtctgagttttcgcgctcctggcgagagaag
cagctggagtattcattccgcagaggcttaatgcagaactacgcaccattttctgtctgc
accagcaatgcgctagattttacctgtagctacctcaaagtgtcgctcacccaagcacag
aaaaccgagctgctaaaaaactatcgcaccctgccagcctttgcggatgttatcgagtcc
ctcagtcaattgaaggctgcgggttaccgcttgttcgccttttccaacgggagtaccgac
gcggttgaagagctgctggtgaacgcgggcattaggacttactttgatggcgtcgtcagt
gtagaggacattaggtcctttaaacccaacccaggggtctacagttattttttacgccaa
tccggtgccctaggcagcgcggcgtggttaatatcaagcaatccattcgatgttattggc
gcgatctcagccgggttacaatcggcttgggtgcaacgctcgcaggatgcgatatttgac
ccttggggcattgagccaacggcgactgtcgcaagtctcaatgagctcaacgacgtttta
gcctag

DBGET integrated database retrieval system