KEGG   Reinekea forsetii: REIFOR_01452Help
Entry
REIFOR_01452      CDS       T05208                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
rfo  Reinekea forsetii
Pathway
rfo00860  Porphyrin and chlorophyll metabolism
rfo01100  Metabolic pathways
rfo01110  Biosynthesis of secondary metabolites
rfo01120  Microbial metabolism in diverse environments
Module
rfo_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
rfo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:rfo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    REIFOR_01452
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rfo01007]
    REIFOR_01452
Enzymes [BR:rfo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     REIFOR_01452
Amino acid related enzymes [BR:rfo01007]
 Aminotransferase (transaminase)
  Class III
   REIFOR_01452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 CTP_transf_3 NTP_transf_3 DUF2064
Motif
Other DBs
NCBI-ProteinID: ATX76598
UniProt: A0A2K8KP99
Position
1563941..1565944
Genome map
AA seq 667 aa AA seqDB search
MGSSRLPGKVLKLINGIPVIELLLFRLSQSKLVDQIVVATSDADADIRLADYVRNLGFSC
SQGSENDVLERFYNAAKEHDADIVVRITGDCPLVDADLVDQVIKGYLSSDVDYFSNGMPP
TYPDGLDVEVFSFSVLEQSHFKSQEPHEREHVTPYARDSGFFKTGNMESVEDFSNIRLTL
DEHDDLILIDNIFNYFSPEIHFTWSEILTLREQMPNIFEINKHIDRNEGASMGAGQKLYK
RAKHVIPGGNMLLSKRPEMFLPDQWPAYFSKAKGCKVWDLDGTELIDMSIMGIGTNILGY
GHQEVDDAVLKCVKDGNMSTLNCPEEVYLAEKLIEINPWADMVRFARAGGEINSIAIRIA
RAHTGRDKVAICGYHGWHDWYLASNLNSDQSLDGHLLPGLQPLGVPRGLTGTVLPFSYNN
IEELENLIKENNGEIAAIKMEVSRNSGPIDDYLEKVRSLATENKIVLIFDECTSGFRETF
GGLHNKFNVEPDIALFAKALGNGYAISACVGRQKIMQAAQNTFISSTFWTERIGPSAALK
TLEVMERVKSWKTITQTGLQIRKRWQLLADNHDLGISHWGLPSLTGYTFQSENALAYKTL
VTQEMLAKGYLASNSVYVSTEHTPTIIDGYFDALQSVFGLIKECEEGRNVSELLKGPICH
AGFKRLN
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgggttccagccggcttcccggcaaagtcttgaagctcataaatggcatccctgtaatt
gaattattgttgtttcgactttcacaatcaaagttagttgatcagatagttgtggctact
tctgatgcggatgccgacatccgtctggcagactatgtgaggaatcttgggtttagttgt
tcgcagggcagtgaaaatgacgtgcttgagcgtttttataatgctgcaaaagaacatgat
gcggatattgtagttcggattacaggggattgtcccctggtggatgctgatttagtggat
caagtcatcaaggggtacctcagttcagatgtcgattattttagtaatgggatgcctcct
acttacccggatgggctagatgttgaggtgtttagttttagcgtattagagcaatcacat
tttaagagtcaggaacctcatgaacgcgagcatgttacaccttatgcgcgggactccggt
tttttcaaaactggcaatatggaatcagttgaagacttttccaatattcgattaactcta
gatgaacatgatgacttaatattaatagataatatctttaactatttttctccagaaata
catttcacctggtctgaaatacttactttaagagaacagatgccgaatatttttgagatt
aataaacacattgataggaatgagggggcttcaatgggcgctgggcaaaagctgtacaag
cgtgctaagcatgtaatacctggtggtaatatgcttttatccaaaaggccagagatgttt
ttaccggatcaatggcctgcatatttcagcaaggcgaaaggctgtaaggtttgggatttg
gatggaaccgaattaatcgatatgagcatcatgggcattggaacaaatatcctaggttat
ggccatcaagaagtagacgatgctgtcttgaaatgtgttaaagacgggaacatgtcaact
cttaattgtccggaggaagtttacttagcggaaaaattaattgagattaacccttgggct
gatatggtccgctttgcaagagctggtggtgaaataaactcaattgctattagaatagct
cgggcacataccggtagggataaagtcgcgatctgtggatatcatggttggcatgattgg
tacttggcttcgaatctaaatagcgatcaaagtctcgatggacatttgctacctgggctt
caaccactgggtgttcctcgtggtttaactggtacagtcttaccctttagctataataat
attgaagagcttgaaaatttaataaaagagaataacggtgagatagctgcaattaaaatg
gaagtatctcgtaatagcggccccatagatgattatttagaaaaagtgcgtagcttggct
actgaaaacaagattgtcttgatttttgacgaatgtacatcaggtttccgtgaaacattt
ggagggttacataataaatttaacgtggagcctgatattgcgctatttgctaaggccttg
ggtaatggatatgcgatttccgcttgcgtcgggagacagaagattatgcaggccgctcaa
aatacatttatcagttctactttttggactgaaagaattgggccttctgcagcgttaaaa
actctcgaggttatggaacgcgttaagtcgtggaaaaccattactcaaactggcttgcag
attcgtaaacggtggcagttgttggcagataaccatgacctaggtattagtcactggggt
ctgccgtcactaacgggctacactttccaaagtgaaaatgcattggcctacaaaacttta
gtaacacaggaaatgttagccaagggttacctcgctagtaatagtgtttatgtgtctaca
gaacatacgccaactattatagatggttactttgatgccctacaatcggtatttggattg
attaaagaatgtgaagaaggtcgtaatgtaagtgagttgttaaaagggcctatttgtcat
gctggttttaaacggctaaattaa

DBGET integrated database retrieval system