KEGG   Reinekea forsetii: REIFOR_03027Help
Entry
REIFOR_03027      CDS       T05208                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
rfo  Reinekea forsetii
Pathway
rfo00780  Biotin metabolism
rfo01100  Metabolic pathways
Module
rfo_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:rfo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    REIFOR_03027
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rfo01007]
    REIFOR_03027
Enzymes [BR:rfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     REIFOR_03027
Amino acid related enzymes [BR:rfo01007]
 Aminotransferase (transaminase)
  Class II
   REIFOR_03027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ATX78146
UniProt: A0A2K8L146
Position
complement(3303021..3304202)
Genome map
AA seq 393 aa AA seqDB search
MPSKAATTALKNFSDMAVHLAARQADHLMRSRLQLQSAQSITPTVDGQRLLSFCSNDYLG
LANHPAIAQAMKEGIDQYGVGSGSSHLVSGHHREHELLEQELAAFTGREAALVFSSGYMA
NVGVMSALMSRRDTIVQDRLNHASLIDGALLSQAKMLRFRHNDMAHLRRQLGLAMGKKLV
VSDGVFSMDGDCAPLLDVSRLCAEHAAWLLVDDAHGIGVLGPHGSGLVNAVGLTSADVPL
LVGTLGKAFGTSGAFVAGDKTTIDYLLQTARPYIYTTATPPALAAATRMALTLVHGADAE
RAHLQTLIGHLRQGVRHLGYQLMPSATAIQPILVGANEAALQLSAQLRARGLLVTAIRPP
TVPVNTARLRVTLSASHSLAQVDQLLNALADVT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ttgcccagcaaggccgcgacaactgcattgaaaaatttttccgatatggcggtccatctg
gctgcccgacaagccgatcatctgatgcgcagccggctgcaattgcagtccgcgcaaagc
attaccccgacagtcgatggccagaggctgttgtccttttgcagtaacgactacctcggc
ctggccaatcatccggcgatcgcccaggcgatgaaagaagggattgaccagtatggcgtc
ggctcgggttcctcgcatctggtcagtggccaccaccgcgaacacgaactgctcgaacag
gaattggcagcctttaccggtcgggaggcggccctggtcttcagttccggctatatggcc
aacgtcggcgttatgtcggcgctgatgtcacggcgcgacaccatcgtgcaggaccgcctg
aatcacgcttcgctgatcgatggcgcgctgctctcgcaagccaagatgctgcgctttcgg
cacaatgatatggcccacctcagacgtcagctcggcctggccatgggtaagaaactggtg
gtcagcgatggggttttttcgatggacggcgattgtgcgcccttgctggatgtctcccgc
ctctgcgcagaacatgccgcttggctgttggtcgatgacgcgcacggcattggcgtgctg
ggcccgcatggatctggcttggttaatgccgtgggcttaaccagtgccgacgttccgcta
ttggtcggaaccctgggcaaagcttttggcacctcgggtgctttcgtcgctggcgacaaa
accaccatcgactatctattgcagacggcccgaccctatatctataccacggcaacaccg
ccggccttggcggcggccacgcgcatggccttaacgctggtgcatggcgccgacgctgag
cgagcgcacctacaaacgctgatcgggcacttgcgtcaaggggtcaggcatctgggttac
cagctgatgccctccgcaacagcgattcaacccattttggtcggtgccaatgaagccgcg
ctgcagttaagcgcgcagctaagagcgcggggcttgctggtcaccgctatccgccccccg
acggtgccggtcaataccgcccgattacgcgtgaccctgagtgctagtcacagcctggcg
caggtcgatcaactgcttaatgcattggcggacgttacatga

DBGET integrated database retrieval system