KEGG   Rhodoferax ferrireducens: Rfer_0455Help
Entry
Rfer_0455         CDS       T00334                                 

Definition
(GenBank) Semialdehyde dehydrogenase, NAD - binding
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00362  Benzoate degradation
rfr00620  Pyruvate metabolism
rfr00621  Dioxin degradation
rfr00622  Xylene degradation
rfr00650  Butanoate metabolism
rfr01100  Metabolic pathways
rfr01120  Microbial metabolism in diverse environments
rfr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rfer_0455
   00650 Butanoate metabolism
    Rfer_0455
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rfer_0455
   00622 Xylene degradation
    Rfer_0455
   00621 Dioxin degradation
    Rfer_0455
Enzymes [BR:rfr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Rfer_0455
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Rfer_0455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABD68207
UniProt: Q221U6
Position
complement(461303..462223)
Genome map
AA seq 306 aa AA seqDB search
MSKKIKCALIGPGNIGTDLLYKLRRSPVLDPVWMVGVDPTSEGLKRARELGLKTTEQGVD
GLLPHVLADGVQIAFDATSAYVHAENSRRLTELGVLVIDLTPAAIGPFCVPPVNLLALVG
RRVMNVNMVTCGGQATIPMIAAISRVQPVRYGEIVATISSKSAGPGTRKNIDEFTRTTSR
AIEQVGGAAKGKAIIIINPAEPPLVMRDTVHCLTETEPDQAKITASIHAMIKEVQKYVPG
YKLVNGPVFDDKRVSVFLEVEGLGDFLPKYSGNLDIMTAAAARTAEMFAEEILAGRINLQ
PMATVA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaatcaaatgtgcgctgatcggtccgggcaacatcggcaccgatctgctc
tacaaactgaggcgcagcccggtgctggacccggtctggatggtcggtgttgacccaact
tccgagggcttgaagcgcgcccgcgagctggggttgaaaaccaccgaacagggtgttgac
ggcctgctgccgcatgtgctggcggatggtgtgcagattgcttttgatgcgacctcggcc
tatgtccatgccgagaactcgcgcaggttgaccgaactcggcgtcctggtgatcgacctg
acaccggcggccatcggcccgttttgtgtaccgccggtcaacctgctggcgcttgtgggc
cggcgggtcatgaacgtcaacatggtgacctgcggcggccaggcgacgattccgatgatc
gccgccatctcccgggtgcagccggtccggtacggcgagattgtggccacgatttcctcc
aagtcggcaggcccgggcacgcgcaagaacatcgacgaatttacccgcaccacctcccgc
gccatcgagcaggtgggcggtgctgccaagggcaaggcgatcatcatcatcaacccggct
gagccgccgctggtgatgcgtgacaccgtgcattgcctgaccgagaccgaacctgatcag
gcgaagatcaccgcgtcgattcacgccatgatcaaggaagtgcagaaatacgtgcccggc
tacaaactggtcaatggcccggtatttgacgataaacgcgtctcggtgtttctggaagtg
gaaggcctgggcgacttcctgcccaagtactccggcaacctcgacatcatgaccgccgcc
gccgcccgcaccgccgagatgtttgccgaggagattctcgctggcaggatcaatcttcaa
cccatggccacggtcgcctga

DBGET integrated database retrieval system