KEGG   Rhodoferax ferrireducens: Rfer_0711Help
Entry
Rfer_0711         CDS       T00334                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase (GDP)
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00051  Fructose and mannose metabolism
rfr00520  Amino sugar and nucleotide sugar metabolism
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rfer_0711
   00520 Amino sugar and nucleotide sugar metabolism
    Rfer_0711
Enzymes [BR:rfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Rfer_0711
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     Rfer_0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding PFOR_II
Motif
Other DBs
NCBI-ProteinID: ABD68462
UniProt: Q220U1
Position
complement(751893..753380)
Genome map
AA seq 495 aa AA seqDB search
MTPTLLIQPVVLSGGSGTRLWPLSREKYPKQLLPLMGTDSLLQATVRRVEGIANLDMAPP
MVVCNEEYRFVIAEQLRLLGKPGTIVLEPCGRNTAPALTLSALAAIKNDADPVLLVMPAD
HVITDIAAFQSVVSQGARLAFDGAVVTFGITPDAPETGYGYIQSGAAYAGPSGTLEANAR
LMARFVEKPDLATAQGYLAAGSYLWNSGLFMLRASVWLSAMKACRPDILAACENAWRQGS
TDGEFVRVGKEAFAQCPSDSIDYAVMERIAAGSAKSDVDAPVLPIGVVLPLSAGWSDVGA
WDALWQVLPKDASGNVSQGDVLLQDCENTLALSEGRLIACVGVSDLVVVETADAILVAHK
DKTQDVKKIVDRLKQQGRSEGIIHRKVFRPWGWYDGVDAGDRFQVKRIVVKPGGTLSLQM
HHHRAEHWIVVSGTARVTCGEKAFLLSENQSTFIPLGTTHRLENPGRVALEMIEVQSGSY
LGEDDIVRFEDVYGR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacacccactctattgatccaacccgttgttctctccggtggctcgggcacgcgcctg
tggccgctgtcgcgcgagaaataccccaagcagttgctgccgctgatgggcactgactcg
ctcttgcaggccaccgtgcgccgcgtcgaaggcattgcgaaccttgatatggcaccaccg
atggtggtgtgcaacgaggaataccgctttgtcattgccgagcaactgcgcctgctcggc
aagccgggcactatcgtgctcgagccttgtggacgaaatacggcgccagcccttaccttg
tctgcgttagctgctattaaaaacgatgcagacccggtcttactggtgatgccggccgac
cacgtcatcaccgacatcgccgcgtttcaaagcgtggtcagccagggcgcgcggctcgcg
tttgatggcgcggtggtcacctttggcatcacgcccgatgcgccggagaccggctacggc
tacatccagtccggcgccgcttacgccgggccatcaggcacgctagaggccaacgcccgc
ctgatggcccgctttgtcgagaagcccgacctggccaccgcgcaaggctacctggcagcg
ggctcctacctgtggaacagtggcctgttcatgctgcgcgcctcggtctggctgtccgcc
atgaaagcctgccgccccgacattctggcggcctgcgaaaacgcgtggcggcagggctca
accgatggcgaatttgtgcgcgtcggcaaggaggcttttgcccagtgcccaagcgactcg
atcgattacgcggtgatggagcggattgcggcaggctcggccaagtctgacgttgatgcg
cccgtgttgccgatcggggtcgtgcttcccttgagcgccggctggtcggacgtcggtgcc
tgggatgccttgtggcaggtgctgcccaaagatgcttccggcaacgtcagccagggcgat
gtgctgctgcaggattgcgagaacacactggcgctgtccgagggacgcctgatcgcctgc
gttggcgtgagcgatctggtggtggtggaaacggccgatgccattctggtcgcgcacaaa
gacaagacgcaggacgtgaagaaaatcgtcgatcgcctcaagcagcagggccgctccgag
ggcatcatccaccgcaaggtatttcgaccctggggctggtacgacggcgtcgatgcgggg
gatcgctttcaggtcaagcgcattgtggtcaagccgggcggcacgctgtcattgcagatg
caccaccaccgcgccgaacactggattgtggtcagcggcacggccagggtcacttgcggc
gaaaaggcatttttgttgtctgaaaaccagtccaccttcatcccgctgggtaccacgcac
cggctggaaaaccccggccgggtggcgctggagatgattgaggtgcaatccggctcgtac
ctgggtgaagacgatatcgtgcgctttgaggatgtgtacggccgctga

DBGET integrated database retrieval system