KEGG   Rhodoferax ferrireducens: Rfer_1216Help
Entry
Rfer_1216         CDS       T00334                                 

Definition
(GenBank) Acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00020  Citrate cycle (TCA cycle)
rfr00620  Pyruvate metabolism
rfr00650  Butanoate metabolism
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01120  Microbial metabolism in diverse environments
rfr01130  Biosynthesis of antibiotics
rfr01200  Carbon metabolism
Module
rfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rfer_1216
   00620 Pyruvate metabolism
    Rfer_1216
   00650 Butanoate metabolism
    Rfer_1216
Enzymes [BR:rfr01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Rfer_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF LUD_dom CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABD68950
UniProt: Q21Z53
Position
1302254..1303807
Genome map
AA seq 517 aa AA seqDB search
MHRNMDSRIRLPFLKERVTSAAKAAEWIQDGMTIGMSGFTRAGDAKVVPLALAERARHEK
LKITLMTGASLGSDVDRTLTEAGVLARRIPFQADPVLRAAINRGEVMYVDQHLSETVELL
RTRQMAPIDIAIIEAIAITESGAIIPTTSVGNSASFAILADKVIVEINLTQSLELEGLHD
IFIPKHRPRREPMPLMTPYDRIGSTAIEIPPEKIVAIVFTEKLDSSSTILPPDTETAAIA
AHLVNFFKEEVAQGRLSESLLPMQAGIGTIANAVMAGFIDSPFKRLTMYSEVLQDSTFDL
FDAGKLDFASGSSITLSAEKSRQVFNDIGKYKDRLVLRPQEVSNHPEIIRRLGLIAINTA
LEADIYGNVNSTHVLGTHMMNGIGGSGDFARNAYLSVFATKSIAKGGKISSIVPMVSHVD
HTEHDVDIIVTEVGLADLRGLAPRERADIIIDRCVAQPYRQMLQAYVARAKQRGGHTPHI
LEEALSWHTRYRDTGSMLTSQITPDIGSYEKSVSLSI
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaaatatggacagccgcatccgcttgccgtttttgaaagagcgcgtgaccagc
gccgccaaggcagccgaatggatacaggacggcatgacgataggcatgagcggctttacc
cgcgcgggcgacgccaaggtcgtgcccctggcgctggccgaacgggcgcgccatgaaaag
ctgaaaatcacattgatgaccggtgcctccctgggcagtgatgtcgacaggacgctgacc
gaagcgggtgtgctggcccggcgtatcccgttccaggccgatccggtgttgcgcgccgcc
atcaaccggggtgaggtgatgtatgtcgatcagcacttgtcggaaacggttgaactgctg
cgcacccggcagatggcaccgatcgacatcgccatcatcgaggccatcgccatcaccgag
agcggcgccatcatcccgaccacgtcggtcggcaacagtgccagttttgcgattctggcg
gacaaggtgattgttgaaatcaacctcacccagtcgctggaactcgaaggcttgcacgac
atcttcatccccaagcaccgcccgcggcgcgaaccgatgcctttgatgacgccgtatgac
cgcatcggcagcaccgcgatcgagattccgcccgaaaaaatcgtggccatcgtcttcacg
gaaaagctcgacagttcctccaccatcctgccgcccgacacggagacggcggccatcgcg
gcgcatctggtgaattttttcaaggaagaagtggcacaagggcgcttgagcgagagcttg
ctgcccatgcaggccggcatcggcaccattgccaacgcggtgatggcagggtttattgac
agcccgttcaagcgcctgacgatgtattccgaggtgttgcaagactccacctttgacctg
ttcgatgccggcaagctcgactttgcgtccggctcctcgatcaccttgtcggcggaaaaa
agccggcaagtgttcaacgacatcggcaagtacaaggaccggctggtgttgcgtccgcaa
gaagtcagcaaccaccccgaaatcatccggcgcctggggctcatcgcgatcaacaccgcg
ctggaagccgacatctatggcaacgtcaactccacccatgtgctgggcacgcacatgatg
aacggcattggcggctcgggcgactttgcgcgcaacgcctacctgtcggtgtttgcgacc
aagtcgattgccaagggcggcaagatatcgagcatcgtgccgatggtgtcgcatgtggac
cataccgaacacgacgtggacatcatcgtcaccgaagtcggcctggccgatctgcgtggt
ctggcaccgcgcgagcgtgccgacatcatcattgaccgatgcgtggcacaaccctaccgg
caaatgttgcaggcttacgtggcgcgcgcgaaacagcgtggcggccacacgccccatatt
ctggaggaagcgctctcgtggcatacccgctaccgcgacacgggctccatgctgaccagc
cagatcacgcccgatatcggttcttacgagaaaagtgtttcgctatctatttaa

DBGET integrated database retrieval system