KEGG   Rhodoferax ferrireducens: Rfer_1561Help
Entry
Rfer_1561         CDS       T00334                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase precursor
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00540  Lipopolysaccharide biosynthesis
rfr01100  Metabolic pathways
Module
rfr_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Rfer_1561
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:rfr01005]
    Rfer_1561
Enzymes [BR:rfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Rfer_1561
Lipopolysaccharide biosynthesis proteins [BR:rfr01005]
 Unusual sugar
  Rfer_1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 Ldh_1_N NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ABD69293
UniProt: Q21Y60
Position
complement(1687197..1688219)
Genome map
AA seq 340 aa AA seqDB search
MTRIVVTGAAGFIGSNIIQGLNARGLNDIIAIDDLTQGDKFRNLAHLKISDYVDASVFYD
LFANGAYGQIEAVFHEGACSDTMESNGKYMMDNNYATSVNLFQACQKRGARLLYASSAAT
YGGSDTFREDPAFERPLNVYGYSKLLFDQRMRRECGNDFRRSVAGKTGQVVGFRYFNVYG
PHEQHKGRMASVAFHQFHQFQAEGKVKLFADYGGYAAGAQMRDFIFIDDVVAVNLWFFDH
PGVSGIFNLGTGRAQPFNDVASSVVNALRGLSGQTALGLEALTEAGLIEYIPFPDALRGK
YQSYTQADLSALRATGCDHPFADVQTGVSNYVQWLAQQDS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcgtcgtgaccggagctgccggttttattggcagcaacatcattcagggg
ctcaacgcccgcggtttgaatgacatcatcgccatcgacgacctgacgcaaggcgacaag
tttcgcaacctcgcccatctcaagatttcagactatgtagacgcgagcgtgttctacgat
ctgtttgccaacggcgcctatggccagatcgaggccgtgtttcatgagggcgcctgcagc
gacaccatggaaagcaatggcaagtacatgatggacaacaactatgcgacctctgtgaac
ttgttccaggcctgccagaagcgcggagcgcgcttgctgtatgcatcgagcgccgctacg
tacggtggctcggacacgttccgggaagacccagcctttgagcgtcctctgaatgtatat
ggctattccaagctgctgtttgatcagcgtatgcgacgtgagtgcggcaacgactttcgg
cgctcggttgccggcaagacgggccaggtagtgggttttcgctacttcaatgtctatggg
ccgcacgagcaacacaaaggccgcatggccagcgtcgcctttcatcagtttcaccagttt
caggctgagggcaaggtcaagctgtttgctgactacggcggctatgccgcaggagcacag
atgcgtgacttcatctttattgacgacgtggtagcggtgaacctgtggttctttgaccac
cccggcgtgtccggcattttcaatctgggcacaggccgggcgcagcccttcaatgacgtg
gccagctcggttgtcaatgcattgcgtggcctctcaggccaaaccgcactcgggcttgaa
gccctcactgaagccggtttgattgagtacatccccttcccggacgccctgcgtggcaag
taccaaagctacacccaggccgatttgagcgccttgcgtgccaccggctgcgaccaccca
ttcgccgatgtgcagaccggtgtgtcgaactatgtgcaatggctggcccagcaggattct
tga

DBGET integrated database retrieval system