KEGG   Rhodoferax ferrireducens: Rfer_1988Help
Entry
Rfer_1988         CDS       T00334                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00970  Aminoacyl-tRNA biosynthesis
rfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rfer_1988
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rfr03029]
    Rfer_1988
Enzymes [BR:rfr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Rfer_1988
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Rfer_1988
Mitochondrial biogenesis [BR:rfr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Rfer_1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Docking
Motif
Other DBs
NCBI-ProteinID: ABD69713
UniProt: Q21WZ0
Position
complement(2143437..2144846)
Genome map
AA seq 469 aa AA seqDB search
MKLVCCFAHQIATWATQQSLTIIACDSMLSDLHTTRQRLRTGQTQATSEIERAIQAAQSP
ACQHAFVQTTFDEARAIANTPGIQTKPLAGLAVSIKDLFDVAGQTTCAGSVVLKDNPPAE
QDSPAVARLRRAGAAFMGRTHMVEFAFSGVGTNPHFGTPVNPCSTDVPRIPGGSSSGAGV
SVATGAAFIGLGSDTGGSIRIPAALNGIVGFKSTARLVPTQGALPLSTTLDTVCAMTRSV
RDAMLAHELLAQRQVTRSSAPLAAYRLAVARTLMQDELDDTVSRAWQRTLATLRRAGAQV
EEVNLTEIGQLQSIQAAGSLAAAESYVWHRQLLERNAAAYDPRVASRIQRGASMSAYDYI
TLLRERQRWISQMASALQGFDAVLSPTVPIVAPPMAELAPGLARDAAFLRVNALLLRNPS
VVNMLDGCALSLPCQTADELPVGLMVWAGALRDDTVLNIALQIERILQK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggtttgctgttttgctcaccaaatagccacttgggccacccagcaaagcctg
acaattatagcctgcgattccatgctttcagacctccacaccacccggcagcgcttgcgc
actggccaaacccaggcaacaagcgaaattgagcgggccattcaggccgcgcaatcacct
gcctgccagcatgccttcgtgcagaccacatttgacgaggcccgcgccatcgccaacacc
ccgggcatccagaccaagccgctggcgggcctggccgtttccatcaaggacctgtttgat
gtggccggacaaaccacctgcgccggctcggtggtcctcaaggacaacccgcccgccgag
caagacagcccggccgttgcgcgtttgcgccgcgctggcgccgccttcatggggcgcacc
catatggtggaatttgcattctcgggcgtcggcaccaatccacactttggtacaccggtc
aacccgtgcagcaccgatgtgccacgcattcccggtggctcctcgtcgggcgctggcgta
tcagtcgctaccggcgccgccttcatcggtctgggaagcgacaccggcggctccatccgc
atcccggccgctctgaacggcattgttggctttaaaagcaccgcccgcctggtgccgacc
caaggtgctctgccactgtccaccacacttgacacggtctgcgccatgacccgcagcgtg
cgtgacgcgatgctggcgcacgagctgctggcccagcgccaggtgacgcgcagctccgcg
ccactggccgcctaccgcctggccgttgcccgcaccctgatgcaggacgagctggacgac
accgtttcacgcgcctggcagcgcaccctggccaccctgcgccgggccggagcccaggtt
gaagaagtcaacctgaccgagatcggccagctgcagtcgattcaggccgctggcagcttg
gcggcggccgagagttacgtttggcatcgccagttacttgagcgcaacgccgctgcttac
gacccacgcgtggcaagccgcatccagcgcggcgccagcatgagtgcctatgactacatc
acgctgctgcgcgagcggcaacgctggatcagccagatggcatcggccctgcagggcttt
gacgcggtgttgtcgcccaccgtcccgatcgtggcaccacccatggcggagctggcacca
ggcctcgcgcgcgacgctgctttcttgcgcgtcaacgccctgctgctgcgcaaccccagc
gtggtcaacatgctcgatggctgcgcgctgtcgctgccgtgccagaccgccgatgagtta
cccgtgggtttgatggtctgggccggtgcgttgcgcgacgacaccgtgctcaatatcgcg
ctgcagatcgagcgaatactacaaaaataa

DBGET integrated database retrieval system