KEGG   Rhodoferax ferrireducens: Rfer_3283Help
Entry
Rfer_3283         CDS       T00334                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00071  Fatty acid degradation
rfr00072  Synthesis and degradation of ketone bodies
rfr00280  Valine, leucine and isoleucine degradation
rfr00310  Lysine degradation
rfr00362  Benzoate degradation
rfr00380  Tryptophan metabolism
rfr00620  Pyruvate metabolism
rfr00630  Glyoxylate and dicarboxylate metabolism
rfr00640  Propanoate metabolism
rfr00650  Butanoate metabolism
rfr00900  Terpenoid backbone biosynthesis
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01120  Microbial metabolism in diverse environments
rfr01130  Biosynthesis of antibiotics
rfr01200  Carbon metabolism
rfr01212  Fatty acid metabolism
rfr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rfer_3283
   00630 Glyoxylate and dicarboxylate metabolism
    Rfer_3283
   00640 Propanoate metabolism
    Rfer_3283
   00650 Butanoate metabolism
    Rfer_3283
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rfer_3283
   00072 Synthesis and degradation of ketone bodies
    Rfer_3283
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rfer_3283
   00310 Lysine degradation
    Rfer_3283
   00380 Tryptophan metabolism
    Rfer_3283
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rfer_3283
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rfer_3283
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rfer_3283
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rfr04147]
    Rfer_3283
Enzymes [BR:rfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rfer_3283
Exosome [BR:rfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rfer_3283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABD70992
UniProt: Q21TB1
Position
3644671..3645837
Genome map
AA seq 388 aa AA seqDB search
MGVCIVGWAHSPFGRLDTLDLESLIGGVTRASLGHAGIAGSEVDGVWLGHLNGGFVPDIF
TSSLALQADDALRWRPATRVENACASGAAALYAACDAIEAGRARVALVIGAEKMTGVSGP
EVTRILGNASYVKEEAARGLTFPGIFAQVALAYFERYGDHSATLAHIAAKNHANGVRNPW
AQMRRDLGFEFCNTVSDRNPLIAAPLRKTDCSMVSDGAAAVILADSSIARQFPRAVALRS
RAQVNDFLPMSRRDAVAFEGPRRAWAKALDNARCSVHDLSLAEVHDCFTIAELLTYEAMG
LAAPGQGARLLAEGTVAAGGKLPINPSGGLKAKGHPIGATGVSMHVLAAMQLMGEAGEMQ
VPGAELVGVFNMGGSAVANYVSILERLQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtttgtatcgttggttgggcgcattcgccgttcgggcgcctggacacgctggat
ctggaatcactgatcggcggcgtgacgcgggcatcgcttggacatgcgggaatcgcgggc
agcgaagtcgacggtgtctggctgggccacttgaacggcggcttcgtgccggacatcttc
acctcctccctggcgctgcaggctgatgatgcgctgcgttggcgacccgccacgcgcgtg
gagaacgcatgcgcctccggcgcggcggccctctatgccgcctgtgatgcgatcgaggcc
gggcgtgcgcgcgtggcgctggtcataggcgccgaaaaaatgaccggcgtgtcgggtccc
gaggtcacgcgcatcctgggcaacgcctcctatgtgaaggaagaagcggcgcggggcctg
acgttcccgggcatcttcgcccaggtggcgctcgcctatttcgaacgctatggtgaccat
tcggccacgctggcgcatattgcggccaagaaccatgccaacggcgtgcgcaacccgtgg
gcgcagatgcgccgggatctgggcttcgagttctgcaacacggtgtcggatagaaacccg
ctcatcgcggcacccttgcgcaagaccgactgttccatggtctcggatggcgccgccgcg
gtgatcctggccgacagttcgatcgccagacaatttccccgtgcggtcgcgttgcgatcc
cgcgcgcaggtcaacgactttctgccgatgtcacgccgggatgcggtcgcgttcgaaggc
ccccgccgggcttgggccaaggcgctggacaatgcccgctgcagcgtgcatgacttgtcg
ctggccgaggtgcatgactgtttcaccattgccgagctgctgacctatgaagcgatgggc
ctggccgcgccaggtcagggcgcgcgactgctggccgaaggtaccgtggctgctggcggc
aagttgccgatcaatccgtccggtggtctcaaagccaaggggcatcccatcggcgccacc
ggcgtatcgatgcatgtgctggcggcgatgcaactgatgggtgaggccggagagatgcag
gtgcccggggccgagctggtgggcgttttcaacatggggggttccgcggtggccaactac
gtcagcatcctggagcgcctgcaatga

DBGET integrated database retrieval system