KEGG   Rhodoferax ferrireducens: Rfer_3790Help
Entry
Rfer_3790         CDS       T00334                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Rfer_3790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rfr03011]
    Rfer_3790
Ribosome [BR:rfr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Rfer_3790
  Bacteria
    Rfer_3790
  Archaea
    Rfer_3790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABD71490
UniProt: Q21RW3
Position
complement(4233251..4233580)
Genome map
AA seq 109 aa AA seqDB search
METRATLRGVRLSVDKGRLVADLIRGKKVDQALNILQFTQKKAAVIIKKVLESAIANAEH
NDGADIDELRVKTIFVEQGASLRRFTARAKGRGNQIRKPTCHVYVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacgtgcaacccttcgtggcgttcgtttatcggtcgacaaaggccgtttggtc
gcggatctgatccgcggcaagaaggtggatcaagccttgaacattttgcagttcacgcag
aaaaaagctgccgtgatcatcaagaaggttcttgagtccgccattgccaacgctgagcac
aatgatggtgccgacatcgacgaactgagggtgaaaaccatcttcgttgagcaaggtgca
tcgctcaggcgcttcacggcccgcgcaaaaggtcgtggcaaccaaatcagaaaacccacg
tgccatgtgtacgtgacggttggtaactga

DBGET integrated database retrieval system