KEGG   Rhodoferax ferrireducens: Rfer_3977Help
Entry
Rfer_3977         CDS       T00334                                 

Definition
(GenBank) beta-ketoacyl synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00061  Fatty acid biosynthesis
rfr00780  Biotin metabolism
rfr01100  Metabolic pathways
rfr01212  Fatty acid metabolism
Module
rfr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Rfer_3977
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Rfer_3977
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rfr01004]
    Rfer_3977
Enzymes [BR:rfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     Rfer_3977
Lipid biosynthesis proteins [BR:rfr01004]
 Fatty acid synthase
  Component type
   Rfer_3977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C ACP_syn_III Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ABD71675
UniProt: Q21RC8
Position
complement(4442889..4443950)
Genome map
AA seq 353 aa AA seqDB search
MKPVYLAGRGLACALGLTVKTSLTALSRGSDTAATCVLPGESAPSFPYRAIADTQSDWNE
RACTLIRRVALEAGAERACDGALFIATSSFDIGAVEQGAAGMDYQAFADKVASWLQWRGP
VYVLSTACTSSLNAMMAAHALLRSGEVEDALVLGVELSNQLTLGGFAALQLLSPDRSKPF
GQDRNGLVLGEAVAALRLSNHQNSPWQMLGGANVVDGRQPTSASALAIVNMYQSALAQCG
LAAQAIDLVKVQAAGSPGNDAIEAQGLRDMFQVIPPLVSLKMAIGHTMGASGAAEVALLT
ACLEQGVWPTYADSVDETLGVNFMAHQPDAVRRVMATILGFGGGHATVVLERT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggtctatctcgcgggccgtgggctggcctgtgcgctgggtttgacggtgaaa
acgtcgttgacggccttgtcccgagggagtgacacggctgccacctgtgttttgcctggt
gagtcagcccccagttttccttatcgtgccatagctgatacccagagtgactggaatgag
cgcgcctgcacgcttattcggcgggtcgccctggaggccggggccgaacgggcctgtgac
ggggccttgttcattgccacatcgtcgtttgacatcggtgccgtggagcagggtgccgca
ggcatggattaccaggccttcgccgacaaggtcgccagctggttgcagtggcgcgggccg
gtgtatgtgctcagcacggcctgcacctccagtctcaacgccatgatggcggcacatgcc
ttgctccgcagcggcgaggtggaggatgccttggtactgggtgtagaactgagcaaccaa
ctgactttgggtggttttgccgccttgcaattgctctcgccagatcgcagcaaacctttt
ggccaggatcgcaacggtctggtcctgggtgaagcggttgctgcattacgtctctccaac
caccaaaactcgccctggcaaatgctcgggggtgccaacgtggtggatggtcggcagccg
accagcgcctcagcccttgccattgtgaacatgtaccaaagtgctttggcgcaatgtggt
ttggctgcgcaggccatcgacctagtcaaggtacaggccgcgggcagtccgggcaacgat
gccattgaggcgcaaggcttgcgtgacatgtttcaagttatcccgcccctggtttcgcta
aagatggccatcggacacaccatgggtgcatccggggccgcagaagttgccttgcttacc
gcctgcctggaacaaggtgtgtggccgacgtatgctgattcggtggatgaaaccttgggc
gtcaatttcatggcacaccagccggatgcggttcgccgtgtcatggcgactatccttgga
ttcggcggcgggcatgccacggtggtgttggagcgcacatga

KEGG   Rhodoferax ferrireducens: Rfer_3984Help
Entry
Rfer_3984         CDS       T00334                                 

Definition
(GenBank) beta-ketoacyl synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00061  Fatty acid biosynthesis
rfr00780  Biotin metabolism
rfr01100  Metabolic pathways
rfr01212  Fatty acid metabolism
Module
rfr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Rfer_3984
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Rfer_3984
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rfr01004]
    Rfer_3984
Enzymes [BR:rfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     Rfer_3984
Lipid biosynthesis proteins [BR:rfr01004]
 Fatty acid synthase
  Component type
   Rfer_3984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ABD71682
UniProt: Q21RC1
Position
4447723..4448916
Genome map
AA seq 397 aa AA seqDB search
MQPLLINTFTTTTALGRGLTDTLSALRAQRSGLQARSWETVDLPTCLGEVDGLDAINLRA
DMQAFDCRNNRLAQLALEQDGFMQSVQTAAEHYGRQRIGVFLGSSTSGILSSEQAYRQRD
PVSGALPASHSYRHTHNMFSVADFVRHYADLQGPACVVSTACSSSAKVFGIAQRMIGCGL
IDAAVVGGVDSLCLTTVYGFNSLQLISNRPCMPFDAQRDGISIGEGAAFILLERADQAQT
DDLLLSGVGESSDAHHMSSPHPEGRGARLAMQAALDMAGLQPQTIGYINLHGTATPSNDA
VEDLGVTAVFGTNTPCSSTKGHTGHTLGAAGSVEAVICALALRHDFLPGGVGTRTPDPRL
HCNYLLTNQEQAITHALSNSFGFGGSNCSLLFSRKRA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgcagccactcttaataaatacattcacaaccaccaccgcgttggggcgtggccttacc
gacacattgagtgcactgcgcgcgcaacgcagcggcttgcaggcacgttcctgggagacg
gtggacctgcccacttgcctgggcgaggttgatggcctggatgccatcaacctacgcgcc
gacatgcaagcattcgactgccgcaacaaccgcctggcccagctcgctctggaacaggac
ggtttcatgcagagtgtgcaaaccgcagcagaacactatggccgacaacgcatcggcgta
tttctgggcagcagcacatcgggcatcctgagttcagagcaagcttatcgccagcgtgac
ccggtcagcggtgccctgcctgccagtcacagttaccggcatacccacaacatgttctcc
gtggcggatttcgtgcgccattacgccgatctgcaagggcctgcgtgtgtggtctctacc
gcctgctcatccagcgccaaagtatttggcatcgcccagcgcatgatcggctgcggcctg
attgatgctgccgtggtggggggtgtcgactccctgtgcctgaccactgtctacggcttc
aattcactgcaattgatatccaaccgcccctgcatgccctttgatgcccagcgcgacggc
atttcgattggtgagggcgcggccttcatcttgcttgaacgtgccgatcaggcccagaca
gatgacctcctgctcagtggtgtcggcgagtccagcgatgcgcaccacatgtcatcgccc
caccccgagggacggggtgcgcgcctggccatgcaagctgccctggacatggcagggctg
cagccgcagaccattggctatatcaacctgcacggcacggccactcccagcaacgacgcg
gtcgaagatctaggggtgaccgcagtgttcggcacaaacaccccctgcagctctaccaag
ggtcacaccggccacaccttgggagccgccggcagtgtggaagccgtgatctgcgcgttg
gcgctacgccatgattttttacccggcggtgtcggcacccgcacccccgatccacgcctg
cattgcaattaccttttgacaaaccaggagcaggccattacccacgcactgagcaactcc
tttggttttggcggcagcaattgcagtttgctgttctcccggaaaagggcatga

DBGET integrated database retrieval system