KEGG   Rhodoferax ferrireducens: Rfer_4034Help
Entry
Rfer_4034         CDS       T00334                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00030  Pentose phosphate pathway
rfr00480  Glutathione metabolism
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01120  Microbial metabolism in diverse environments
rfr01130  Biosynthesis of antibiotics
rfr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rfer_4034
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rfer_4034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rfr04147]
    Rfer_4034
Enzymes [BR:rfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Rfer_4034
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Rfer_4034
Exosome [BR:rfr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Rfer_4034
  Exosomal proteins of colorectal cancer cells
   Rfer_4034
  Exosomal proteins of bladder cancer cells
   Rfer_4034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABD71732
UniProt: Q21R71
Position
4497119..4498537
Genome map
AA seq 472 aa AA seqDB search
MGLEMPDSAQRAPAPSDALVLFGVTGDLAFKKIFPALYAMCREGTLSVPVIGVASSAWTV
EQLRERARQSVEANGAVDDPGALERLLSLLQYVSGDYKEPGTFDALKKTLGQARRPTHYL
AIPPALFSNVIRGLGSAGLGAQARVVVEKPFGRDLASARELNRVAFEVFAEDAIFRIDHF
LAKEAIMNILYFRFANSFLEPIWNRNHVASVQITLAEKFGVLGRGAFYESAGCLRDVVQN
HLFQIVALLAMEPPAYQGFDAVHSAKANVFQAMRPLQPTDLMRGQYVGYRDEPHVAPDSD
VETYCALRLHIDSWRWAGVPWYLRSGKCLADTASEVRVQLKPPPQRLFADAAAAGDHANY
LRFHLSPCSSIALAARVKRAGKDFVGEQRELLLTEEERVEETPYQRLLSDAMAGADALFT
REDAVEAAWAVVDPVLEDHQAAHPYPPGSWGPQAGDALIAADGGWHNPEPAC
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggtctggagatgcccgacagtgcgcagcgcgcgccagcgccctccgacgcgctggtg
ctctttggcgtgactggcgacctggcgttcaaaaaaatcttcccggcgctctatgcgatg
tgccgtgaggggacgctgagcgtgccggtgattggcgtggcctcgtcggcctggaccgtc
gagcagttgcgcgagcgtgcgaggcagagcgtggaggccaacggcgccgtggacgacccg
ggcgcgctcgagcgcttgctgtcgttgctgcagtatgtgagcggcgactacaaggagcct
ggcaccttcgacgcgctcaaaaagaccttgggccaggcgcggcgcccgacgcattacctg
gccattccacccgcgctgttttcaaacgtcatccggggactcggcagcgccggtctgggc
gcgcaggcccgcgtggttgtagagaagccgttcgggcgcgacctggcctcggcacgcgag
ctcaaccgcgtcgcgtttgaggtatttgccgaagacgcgatctttcgcatcgatcacttc
ctggccaaggaagcgatcatgaacatcctgtatttccgcttcgccaactcttttcttgag
ccgatctggaaccgcaaccacgtcgcgagtgtgcaaatcacgctggccgagaagttcggc
gtgctgggccgcggcgcgttttacgagagcgccggctgcctgcgcgacgtggtgcagaac
catttgttccagatcgtcgccctgctcgcgatggagccgccggcgtaccagggcttcgat
gcggtgcacagcgccaaggcgaacgtttttcaggccatgcgcccgctgcaaccgaccgac
ctgatgcggggccagtacgtcggctaccgcgacgagccccacgtcgcaccggactctgac
gtcgagacctactgcgcgctgcggctgcacattgattcctggcgctgggccggggtgccg
tggtacctgcgctcgggcaaatgcctggccgacaccgccagcgaggtgcgggtgcaactc
aagccgccaccgcaacgactgttcgcggatgccgcagcggccggtgaccatgccaactac
ctgcgcttccatttgtcgccgtgttcgtcgatcgcgctggccgcgcgcgtcaagcgcgct
ggcaaggactttgtcggcgaacaacgcgagctgctgttaaccgaggaggaacgcgtcgaa
gaaacgccgtatcagcgcctgctcagcgacgcgatggcgggtgcagacgcgctgtttacc
cgggaagacgcggtggaggcggcgtgggcggtggtcgatccggtgctggaagaccatcag
gcggcgcacccctatccacccggcagctggggcccgcaggcgggcgatgcattgatcgcc
gccgacggcggctggcacaacccggaaccggcctgctag

DBGET integrated database retrieval system