KEGG   Rhodoferax ferrireducens: Rfer_4067Help
Entry
Rfer_4067         CDS       T00334                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00061  Fatty acid biosynthesis
rfr00071  Fatty acid degradation
rfr01100  Metabolic pathways
rfr01212  Fatty acid metabolism
rfr02024  Quorum sensing
Module
rfr_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Rfer_4067
   00071 Fatty acid degradation
    Rfer_4067
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rfer_4067
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rfr01004]
    Rfer_4067
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rfr04147]
    Rfer_4067
Enzymes [BR:rfr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Rfer_4067
Lipid biosynthesis proteins [BR:rfr01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Rfer_4067
Exosome [BR:rfr04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Rfer_4067
  Exosomal proteins of breast cancer cells
   Rfer_4067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding CHASE8 LamB_YcsF
Motif
Other DBs
NCBI-ProteinID: ABD71765
UniProt: Q21R38
Position
4534527..4536338
Genome map
AA seq 603 aa AA seqDB search
MNHPTALPELTLAQMLRERARAAPARLGIRQKDFGIWKPVSWGSYYLRACHFGLGLRALG
LPEGGHVGVIAENRIEWVLAQMGVSLVGAVAVGVYSTSPTSEVAYVVAHADIEIMVCEDQ
EQAEKVLAALEQLPRLRKIVVMETKGLRSFAPEARQLIATFDEVEQLGAASGNLALIDEV
LAHQTLDDIGLMIYTSGSTGKPKGAMISYRNIRGVVPGIVERLRLTAETSHLSYLPLCHV
AEQMLTTFAPIYIGSQVNFGESIRTVQEDLREVAPTMFLGVPRIWEKMHATISIKLQETG
RLRRVLFRQAYAACQGLAEKPRAAWSIKEKLVFGLSYWTFFRALQNFIGLRKAQVALTGA
APIPPDVVRFFRVLGVPLVEVYGLTESTGMVTGHPIDQVIVGTVGTPTLGVEHRIGENGE
LLLRGDMVFAGYYKNPEATATSIRDGWLYTGDVVREEGGQLKIVDRLKDIMITAGGKNLT
PSEIENTMKGSPFIKECIIVAEGRKFVGALVQIDFEVMSQWAEARRIAFTHFRSLVERPE
VRALIDAEIAQGNTRLAQVSHIRKFHLLTKELDHDDGEVTATMKVRRSSIYKTYAAEIEA
LYH
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccccaccgcactccctgaactgaccctggcgcagatgctgcgcgagcgtgcg
cgcgcggcccccgcgcgtctcggcatccggcaaaaggactttggcatctggaagccggtc
agctggggcagctactacctgcgcgcctgccacttcggtctgggcctgcgcgccctgggc
ttgccagagggcggccatgtcggcgtgatcgccgaaaaccgcatcgaatgggtgctggcg
cagatgggcgtcagcctggtcggcgccgtcgccgtgggcgtctactccaccagcccgacg
tccgaggtggcctacgtggtggcccacgctgacatcgagatcatggtctgcgaagaccag
gagcaggccgagaaggtgttggccgcgcttgagcagttgccgcggctgcgcaagatcgtg
gtcatggaaaccaagggcctgcgcagcttcgcccctgaagcgcgtcaactgatcgccacc
tttgacgaggtggaacaactcggcgccgcgagcggcaatcttgccctgatcgacgaggta
ttggcgcaccagacgctggacgacattggactcatgatctacacctcgggctcgaccggc
aagcccaagggcgcgatgatttcctaccgcaacatccgcggcgtggtgcccggcatcgtg
gagcgcttgcgcctcacggccgagaccagccacctgtcctacctgccgctgtgccatgtg
gcggagcagatgctgaccacctttgcgccgatctacatcggctcgcaggtcaactttggc
gaatcgatccgcaccgtgcaggaagacctgcgcgaggtcgcgcccaccatgttcctgggc
gtgccccgcatctgggaaaaaatgcacgccaccatcagcatcaagctgcaggaaaccggc
cgcttgcgccgcgtgctgttcagacaagcctacgcggcctgccagggcctggccgaaaaa
ccgcgtgccgcctggagcatcaaagaaaagctggtgtttgggctgagttactggactttc
tttcgcgccctgcagaacttcatcggcctgcgcaaggcgcaagtggcgctcacgggcgcg
gcaccgatcccgcccgacgtggtgcgtttctttcgcgtgctgggcgtgccgctggtcgag
gtctatgggctgaccgagtccaccggcatggtcacgggccacccgattgaccaagtgatc
gtcggcaccgtgggcacgcccacgctgggcgtggagcaccgcatcggcgagaacggcgaa
ctgctgctgcgcggcgacatggtgtttgccggctactacaagaaccctgaggccacggcg
accagcatccgcgacggctggctctacaccggcgacgtggtgcgcgaggagggcggccag
ctcaagatcgtcgaccgcctgaaagacatcatgatcaccgccggtggcaagaacctgacg
ccctcggaaatcgaaaacaccatgaagggcagcccttttatcaaggaatgcatcatcgtg
gccgaggggcgcaagttcgtcggcgcgctggtgcagatcgactttgaagtcatgagccag
tgggccgaagcacgccgcatcgcgttcacccacttccgctcgctcgtggaacggcccgag
gtgcgcgcgctgatcgacgccgaaatcgcgcagggcaacacccgactggcgcaggtctcg
cacatccgcaagttccacctgctgaccaaggaactggaccacgacgacggtgaagtgacc
gccaccatgaaggtgcgccgctccagcatctacaagacctacgcggcagaaatcgaagcc
ctgtaccactga

DBGET integrated database retrieval system