KEGG   Rhodoferax ferrireducens: Rfer_4252
Entry
Rfer_4252         CDS       T00334                                 

Definition
(GenBank) conjugation TrbI-like protein
  KO
K20533  type IV secretion system protein TrbI
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rfer_4252
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rfr02044]
    Rfer_4252
Secretion system [BR:rfr02044]
 Type IV secretion system
  Trb secretion system protein
   Rfer_4252
SSDB
Motif
Pfam: TrbI DUF2981
Other DBs
NCBI-ProteinID: ABD71939
UniProt: Q21QK6
Position
plasmid1:complement(6727..8049)
AA seq 440 aa
MEVPPKGLIPRSGLFFFIGIFVLMLIAFAAYDLTKSRPAPPIAKDANDKAGTPMTAVNAN
PPPPPGDIAEIARAQGAKADQVVAAEARISANASTQPLPAGTVTGNGATQSRRGMILPKG
MSNPDGTAGATSIESASDQREAAAAVSGIFSMTGSGEGVAGALGRMGAPGASEMETSADA
VQRQIDALTKTQNGTNQDAGAPFDVAKILASLQGGQKAPVTGKDQAWLKESASETVSEAV
YAKTPASPWMLFQGTRVPIVLREEVNSDLPGSVTAMSTSPVYDSINQCAVLLPPGTKFYG
AYSADIRPGQSRVLFAFRRMILPDGRSVVLDGAQAVDQRGAVGAEGDVNNHFLQMYGYGF
AIALLSSAGGSGGANVTTTDVSGKSTTTTIAGQVLADIGGKIMSRNATIPPTIKLDIGSR
MFLTIVRDIALAPTSRNHCK
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggaggttccgccaaaaggactgatcccacggtctgggctcttcttcttcattggaata
ttcgttctgatgctgattgcctttgctgcgtacgacctgacaaaatcacgtcctgcgcca
cctatagcgaaggacgccaacgacaaggccggcaccccaatgacggcggtaaacgccaac
ccaccaccaccaccgggtgacatagcagagatagctcgcgcccaaggagcgaaggcagat
caagtcgtcgctgctgaagcccgcatttccgcgaatgcaagcacacagccactccccgct
ggcacggtcacgggcaatggcgccactcaatcacggcggggcatgattcttcccaaaggc
atgagcaaccctgatggtacggctggcgccacttcgattgagtcggccagcgatcagcgt
gaggctgccgcagctgtatcgggcatcttctccatgacgggcagtggagaaggggttgct
ggtgctttaggacgcatgggtgcgccaggcgcaagtgagatggagacttcagcagatgct
gtgcaacgccaaatcgatgcgctaacaaagacccagaatggcacaaatcaggacgcgggt
gcccccttcgatgttgcaaagatattggcgagcctgcaaggcggtcaaaaagcaccagtc
acaggcaaagaccaggcatggctcaaggagtcggccagcgagacggtgtccgaggccgtc
tacgccaaaacaccggcgtcgccgtggatgctgtttcaaggtacgcgagttcccattgtg
ctgcgtgaagaggtcaatagcgatctccccggctctgtgacggccatgtcgacatcgccg
gtctatgacagcatcaatcagtgcgcagtgcttcttcctcctggaaccaagttttatgga
gcctacagcgccgatattcgccctggacagtcacgcgtactgttcgcatttcggcgcatg
attttgcccgatggacgctccgtagtcctcgatggagcacaggccgtcgaccagcgcggc
gccgtaggcgctgaaggtgatgtcaacaaccactttctgcaaatgtacgggtacggcttt
gcgatagcactgctttcgagcgcaggtggaagtggtggggcgaatgtgacaactactgac
gtcagcggaaaatccaccaccacaacgattgccggtcaagtcctggccgacattggcggc
aagatcatgagccgtaacgccactattcctccaaccatcaaactcgatattggaagtcgc
atgtttttgaccatcgtccgagacattgcgctcgcgcctacatcgaggaatcattgcaaa
tga

DBGET integrated database retrieval system