KEGG   Rhodoferax ferrireducens: Rfer_4259
Entry
Rfer_4259         CDS       T00334                                 
Name
(GenBank) hypothetical protein
  KO
K20266  type IV secretion system protein TrbJ
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rfer_4259
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rfr02044]
    Rfer_4259
Secretion system [BR:rfr02044]
 Type IV secretion system
  Trb secretion system protein
   Rfer_4259
SSDB
Motif
Pfam: WRNPLPNID
Other DBs
NCBI-ProteinID: ABD71946
UniProt: Q21QJ9
Position
plasmid1:complement(14893..15657)
AA seq 254 aa
MRRLFISLCLVFTGMNAFAMASGSVVFDPANYSQTLITAGQSVKLLSESVGGNLTKLRQL
QELYKQGRAIASGDVNAIAGVVGGPQLQSQIRDMQGMKKALTNLNGNIDDLTGRYNYTMQ
MSQKYGVSVQEYQAAQARRVSQGIESARLEQQQNMRALKSVDDSYVQLQKWQERLPETNT
ELMQMMNMHMTMLNTNNAQVLSYMARNNAAEQDRTVKTAAEEQSKRDYEEKNAADAKRHG
DDTWNRLIGGFRKK
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcgtagattgtttatttccctgtgcttggtatttactggaatgaatgcgtttgccatg
gcttcaggcagcgtcgtgtttgatcccgccaactacagtcaaaccctgatcactgccggt
caatcagtcaaacttctcagtgagtctgttggcggcaatttgacaaaattgagacaactg
caggaactttacaaacagggcagggcgattgcttcgggcgatgtgaatgccatcgccggg
gttgtcggcggacctcaactccagtcccagattcgagacatgcaagggatgaagaaagca
cttacaaatctcaatgggaatattgatgacttgactgggcgatataactacacgatgcag
atgtcacaaaagtacggcgtgagcgtgcaggaatatcaggctgcgcaagcacgacgggtg
tcgcaaggcattgagtcggcaagactggaacaacaacaaaacatgcgggcgctcaagagc
gtggatgactcctatgtgcaactacaaaagtggcaagagagattgccagaaacaaatacc
gagttgatgcagatgatgaatatgcacatgacgatgcttaacacgaataatgcacaagtg
ctgtcctacatggcgcgcaataatgcagcagaacaggaccgtacggttaagacagcggcg
gaagaacagagcaagagagattacgaggaaaagaatgcagcagatgccaaacggcatggc
gacgatacttggaatagactgataggcggattcaggaagaaataa

DBGET integrated database retrieval system