KEGG   Rhizobium gallicum: RGR602_CH01586Help
Entry
RGR602_CH01586    CDS       T03539                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rga  Rhizobium gallicum
Pathway
rga03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rga00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RGR602_CH01586 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rga03011]
    RGR602_CH01586 (rplV)
Ribosome [BR:rga03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RGR602_CH01586 (rplV)
  Bacteria
    RGR602_CH01586 (rplV)
  Archaea
    RGR602_CH01586 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AJD40930
UniProt: A0A0B4X2L8
Position
1584837..1585226
Genome map
AA seq 129 aa AA seqDB search
MGKAKAERRLKDNEAQAVARTLRVSPQKLNLVAAAIRGKKVDRALAELEFSRKRIAGAVK
KTLESAIANAENNHDLDVDSLVVAEAYVGKSIVMKRFHARGRGRASRIEKPFAHLTIVVR
EVQAQEEAA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggcaaaagccgaacgccggctgaaggacaacgaggcgcaagcagtcgcccgc
acgctccgcgtcagcccacagaagctcaacctggttgctgcggccatccgcggcaagaag
gttgaccgcgcactcgctgagctggagttctcccgcaagcgcatcgcaggcgccgtcaag
aagacgctcgaatctgcgatcgccaacgccgagaacaaccacgatctcgacgtcgactcg
ctggtcgtagcagaagcctatgtcggcaagtcgatcgtcatgaagcgcttccacgctcgt
ggccgcggccgtgcatctcgcatcgagaagccgttcgcccacctgacgatcgtcgtccgc
gaagtgcaggcacaagaggaggccgcataa

DBGET integrated database retrieval system