KEGG   Rhizobium gallicum: RGR602_CH02029Help
Entry
RGR602_CH02029    CDS       T03539                                 

Gene name
adhI-1
Definition
(GenBank) bifunctional alcohol dehydrogenase class 3/S-(hydroxymethyl)glutathione dehydrogenase 1
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
rga  Rhizobium gallicum
Pathway
rga00010  Glycolysis / Gluconeogenesis
rga00071  Fatty acid degradation
rga00350  Tyrosine metabolism
rga00625  Chloroalkane and chloroalkene degradation
rga00626  Naphthalene degradation
rga00680  Methane metabolism
rga01100  Metabolic pathways
rga01110  Biosynthesis of secondary metabolites
rga01120  Microbial metabolism in diverse environments
rga01130  Biosynthesis of antibiotics
rga01200  Carbon metabolism
rga01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGR602_CH02029 (adhI-1)
  09102 Energy metabolism
   00680 Methane metabolism
    RGR602_CH02029 (adhI-1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RGR602_CH02029 (adhI-1)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    RGR602_CH02029 (adhI-1)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RGR602_CH02029 (adhI-1)
   00626 Naphthalene degradation
    RGR602_CH02029 (adhI-1)
Enzymes [BR:rga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RGR602_CH02029 (adhI-1)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     RGR602_CH02029 (adhI-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AJD41357
UniProt: A0A0B4X496
Position
2000632..2001759
Genome map
AA seq 375 aa AA seqDB search
MDVRAAVAVQAGKPLEVMTVQLEGPRAGEVLVEVKATGICHTDDFTLSGADPEGLFPAIL
GHEGAGIVVDVGLGVTSVKKGDHVIPLYTPECRECPSCLSRKTNLCTAIRATQGQGLMPD
GTSRFSIGKDKIHHYMGCSTFANYTVLPEIAVAKVNADAPFDKICYIGCGVTTGIGAVIN
TAKVEIGATAIVFGLGGIGLNVLQGLKLAGADMIIGVDINNDRKVWGEKFGMTHFVNPKE
VGDDIVPYLVNMTKRGADQIGGADYTFDCTGNTKVMRQALEASHRGWGKSVVIGVAGAGQ
EISTRPFQLVTGRSWMGTAFGGARGRTDVPKIVDWYMQGKIQIDPMITHTMPLEDINKGF
ELMHSGQSIRGVVLY
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggacgttcgcgccgccgttgccgttcaggctggaaaaccgctggaagtcatgaccgtg
cagctggaaggcccgcgggccggcgaggttctggtcgaggtcaaggcgaccggcatctgc
cacacggacgatttcacgctgtctggggccgatccggagggcctgtttccggcaatcctc
ggccatgagggtgccggcatcgtcgtcgatgtcggcctgggcgtcacttcggtcaagaag
ggcgaccacgtcattccgctctacacgccggaatgccgtgaatgcccgtcctgcctgtcg
cgcaagaccaatctgtgcacggcgatccgcgccactcagggccaggggctgatgccggac
ggcacgagccgcttttcgatcggcaaggacaagatccatcattacatgggctgctcgacc
tttgccaattacacggtgctgcccgagatcgccgttgccaaggtcaatgcggacgctccc
ttcgacaagatctgctacatcggctgcggcgtcaccaccggcatcggcgccgtcatcaac
accgccaaggtggagatcggcgccacggcgatcgtcttcggcctcggcggcatcggcctc
aacgttctccagggcctgaagcttgccggtgccgacatgatcatcggtgtcgacatcaac
aatgaccgcaaggtgtggggcgaaaagtttggcatgacgcatttcgtcaatcccaaggag
gtcggcgacgacatcgtgccctatctcgtcaacatgacgaagcgtggcgccgaccagatc
ggcggcgccgactacaccttcgactgcaccggcaacaccaaggtgatgcgccaggcgctg
gaagccagccatcgcggctggggcaagtcggtcgtcatcggggtggccggtgccggccag
gaaatctccacccgcccgttccagctggtcaccggccgcagctggatgggcaccgccttt
ggcggcgcgcgcggccgcaccgacgtgccgaagatcgtcgactggtacatgcaaggcaag
atccagatcgatccgatgatcacccatacgatgccgctcgaagacatcaacaagggcttc
gaactcatgcattccggtcaaagcatccgcggcgtggtgctgtattga

DBGET integrated database retrieval system