KEGG   Rhizobium gallicum: RGR602_CH02425Help
Entry
RGR602_CH02425    CDS       T03539                                 

Definition
(GenBank) P-loop NTPase domain-containing protein
  KO
K01144  exodeoxyribonuclease V [EC:3.1.11.5]
Organism
rga  Rhizobium gallicum
Brite
KEGG Orthology (KO) [BR:rga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RGR602_CH02425
Enzymes [BR:rga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     RGR602_CH02425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 UvrD_C_2 AAA_19 Viral_helicase1 PIF1 AAA_16 ATPase_2 AAA_33 AAA_22 TniB UvrD_C SH3_13 AAA NACHT TsaE ATPase NB-ARC AAA_11 AAA_24 ResIII AAA_18 AAA_28 AAA_5
Motif
Other DBs
NCBI-ProteinID: AJD41750
UniProt: A0A0B4X4V3
Position
complement(2401701..2402828)
Genome map
AA seq 375 aa AA seqDB search
MQFAPQQDEALKAVSKWLKEGRSPLFRLFGYAGTGKTTLAKHFAENVDGDVLFAAFTGKA
AQVLRSRGASNAKTIHSLIYRPRGEEAVEDEETGKTSMTPMFTINRQSPVAKAALIIVDE
CSMVDEALGKDLMSFGTPILVLGDPGQLPPVSGGGFFTNQEPDYLLTDIHRQARDNPIIK
LAMQVREGNEIMYGDYGTAQVIAKNEVNQALVLDADQVLVGTNRTRRRYNQRLRELKGFS
ADYPQTGDKLVCLRNDPAKGLLNGSLWQVMTSSKETTKPGINLLVRPEDDDMDRGAAKIK
LLKQVFEDVEGEIPWNTRKRYDEFDYGYALTVHKAQGSQWNNVVLFDESWAFRDTRERWL
YTAITRAAETLTIVR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgctccgcaacaggacgaagccctgaaggccgtttcgaaatggctgaaggag
ggccgctcgccgctcttccgtctgttcggctatgccggaacgggcaagacgacgctcgcg
aagcattttgcggagaatgtcgatggcgacgtgttgtttgccgcctttaccggcaaggcg
gcgcaagtgttgcgatcgcgcggtgccagcaatgccaagaccatccattcgctgatctat
cgcccgcgtggggaagaggctgtcgaggacgaggaaaccggcaagacctcgatgacgccg
atgttcaccatcaaccggcagagcccggtcgccaaggcggcgctgatcatcgtcgacgaa
tgctcgatggtcgacgaggcgcttggaaaggacctgatgagcttcggcacaccgatcctg
gtgctcggcgatcccggacagctgccgccggtttcgggcggcggcttctttaccaatcag
gagccggattacctgctgacggacattcaccgccaggcgcgcgacaatccgatcattaag
cttgcgatgcaggtgcgcgaaggcaacgagatcatgtatggcgactacggcaccgcccag
gtgatcgccaagaacgaagtcaaccaggccctggtgctcgatgcagatcaggtgcttgtc
ggcaccaaccgcacgcggcgccgctataaccagcgcctgcgggagttgaagggcttttcg
gcggattatccgcagacgggcgacaagctcgtctgcctgcgcaacgaccccgccaagggg
ctgctcaacggttcgctctggcaggtcatgacgtcatcgaaggagacgacgaagccgggc
atcaacctgctcgtgcggccggaagacgacgacatggatcgcggcgcggccaagatcaag
ctgctgaagcaggttttcgaggatgtcgaaggcgaaatcccgtggaatacgcgcaagcgc
tacgacgaattcgattacggctatgcgctcaccgtgcacaaggcgcagggctcgcagtgg
aacaatgtcgtgcttttcgatgaaagttgggccttccgcgatacgcgcgaacgctggctt
tacacggcgataacgcgcgcggcggagacgctgacgatcgtgcggtga

DBGET integrated database retrieval system