KEGG   Rhizobium gallicum: RGR602_CH03555Help
Entry
RGR602_CH03555    CDS       T03539                                 

Definition
(GenBank) beta-glucosidase protein
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
rga  Rhizobium gallicum
Pathway
rga00460  Cyanoamino acid metabolism
rga00500  Starch and sucrose metabolism
rga01100  Metabolic pathways
rga01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RGR602_CH03555
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    RGR602_CH03555
Enzymes [BR:rga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     RGR602_CH03555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AJD42862
UniProt: A0A0B4X8M0
Position
complement(3597605..3598978)
Genome map
AA seq 457 aa AA seqDB search
MIEPKTLAARFPGDFTFGVATAAFQIEGASKADGRKASIWDAFCNMPGRVYDRHNGDIAC
DHYNRLEQDLDLIKDMGVEAYRFSIAWPRIIPDGTGPVNEAGLDFYDRLVDGCKARGIKT
FATLYHWDLPLLLAGDGGWTARSTAYAFQRYAKTVMARLGDRLDSVATFNEPWCIVWLSH
LYGIHAPGERNMQAALHAMHYMNLAHGLGVEAIRAEAPKVPAGLVLNAMPVIPGSQSKAD
IAAGERAHQFHNGAFFDPVFKGEYPSEFVEALGDRMPIIEDEDMKIISQKLDWWGLNYYT
PLRVADDPVKNGDFPWTAEAPRASDVKTDIGWEVYAPGLKHVVEDLYRRYELPECYITEN
GACYNMDVVNGEVDDQPRLDYYSDHLAVVADLIKDGYPMRGYFAWSLMDNFEWAEGYKMR
FGLVHVDYDTQVRTVKKSGKWYRQLASQFPAGNHKAG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagcctaagacactcgccgcccgctttccgggcgatttcacctttggcgtcgcg
acggctgccttccagatcgaaggtgccagtaaagcggatgggcgcaaggcgtctatctgg
gatgccttctgcaacatgccgggccgtgtctatgaccgccataatggcgatattgcctgc
gatcactacaaccggctcgaacaggaccttgacctgatcaaggacatgggtgtcgaggcc
tatcgcttctcgatcgcctggccgcgcatcattccggatggaaccgggcctgtgaacgaa
gccggcctcgatttctacgaccgcctcgtcgacggttgcaaggcgcgtggcatcaagacc
ttcgcgacgctttatcactgggacctgccgctgctgttggcaggcgacggcggctggacg
gcgcgctccacggcctacgcctttcagcgctacgcaaagacggtcatggcgcgtctcggc
gaccggctcgacagcgtcgccaccttcaacgaaccatggtgcatcgtctggctcagccat
ctctacggcatccatgcgccgggcgagcgcaacatgcaggcagcgcttcacgccatgcac
tacatgaaccttgcgcacggtcttggcgtcgaggcgatccgcgccgaggcgccgaaggtg
ccagccggcctggtgctgaatgcgatgcccgtcattccgggatcgcagagcaaggcggat
attgcagcgggcgaacgcgcgcatcagttccacaacggcgcttttttcgatccggtcttc
aagggcgagtatccgagcgagttcgtggaagcgctcggcgaccgcatgcccatcatcgaa
gatgaagacatgaagatcatcagccagaagctcgattggtggggcctcaactactacacg
ccgctgcgtgtcgccgacgacccggtgaaaaacggcgatttcccctggacggccgaagcg
ccgcgtgccagcgacgtgaagacagatatcggctgggaggtttatgcgcccggcctcaag
cacgtcgttgaagacctctatcgtcgctatgaactgccggaatgctacatcaccgaaaac
ggcgcctgctacaacatggatgtggtcaatggcgaggtcgatgaccagccgcgcctcgat
tattacagcgatcacttggccgtcgttgccgacctcatcaaggacggctacccgatgcgc
ggttacttcgcctggagcctgatggacaacttcgaatgggcggaaggctacaagatgcgt
ttcggcctcgtgcatgtcgattacgacacccaggtgcgtaccgtgaaaaagagcggtaag
tggtaccggcaactggcaagccagtttccggcgggcaatcacaaggcgggttga

DBGET integrated database retrieval system