KEGG   Rhizobium gallicum: RGR602_PB00364Help
Entry
RGR602_PB00364    CDS       T03539                                 

Gene name
phbA-2
Definition
(GenBank) acetyl-CoA acetyltransferase 2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rga  Rhizobium gallicum
Pathway
rga00071  Fatty acid degradation
rga00072  Synthesis and degradation of ketone bodies
rga00280  Valine, leucine and isoleucine degradation
rga00310  Lysine degradation
rga00362  Benzoate degradation
rga00380  Tryptophan metabolism
rga00620  Pyruvate metabolism
rga00630  Glyoxylate and dicarboxylate metabolism
rga00640  Propanoate metabolism
rga00650  Butanoate metabolism
rga00900  Terpenoid backbone biosynthesis
rga01100  Metabolic pathways
rga01110  Biosynthesis of secondary metabolites
rga01120  Microbial metabolism in diverse environments
rga01130  Biosynthesis of antibiotics
rga01200  Carbon metabolism
rga01212  Fatty acid metabolism
rga02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RGR602_PB00364 (phbA-2)
   00630 Glyoxylate and dicarboxylate metabolism
    RGR602_PB00364 (phbA-2)
   00640 Propanoate metabolism
    RGR602_PB00364 (phbA-2)
   00650 Butanoate metabolism
    RGR602_PB00364 (phbA-2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RGR602_PB00364 (phbA-2)
   00072 Synthesis and degradation of ketone bodies
    RGR602_PB00364 (phbA-2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RGR602_PB00364 (phbA-2)
   00310 Lysine degradation
    RGR602_PB00364 (phbA-2)
   00380 Tryptophan metabolism
    RGR602_PB00364 (phbA-2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RGR602_PB00364 (phbA-2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RGR602_PB00364 (phbA-2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RGR602_PB00364 (phbA-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rga04147]
    RGR602_PB00364 (phbA-2)
Enzymes [BR:rga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RGR602_PB00364 (phbA-2)
Exosome [BR:rga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RGR602_PB00364 (phbA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJD43895
UniProt: A0A0B4XAY1
Position
pRgalR602b:344089..345270
Genome map
AA seq 393 aa AA seqDB search
MSTPSIVIARAARTAVGSFNGAFSNTPAHELGAAVIKGVLERAGVEAGEVDEVILGQVLQ
AGEGQNPARQAAIKAGLPQEATAWGMNQLCGSGLRAVALGMQQIASGDADIIIAGGMESM
SMAPHCAHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGITAENVARQWQLSREEQDTFA
LASQNKAEAAQKAGRFADEIVPFIVKTRKGDVSVDQDEYIRHGATLDQMTKLRPAFDKQG
TVTAGNASGLNDGAAATLLMTEAQASKRGIQPLARIISWATAGVDPQVMGTGPIPASRKA
LAKAGWAIGDVELVEANEAFAAQACAVNKDLGWNPDIVNVNGGAIAIGHPIGASGARVLN
TLLFELKRRGAKKGLATLCIGGGMGVAMCVEAM
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccatcgatcgtcatcgcccgcgccgcccgcaccgcggtcgggtccttcaac
ggcgcgttcagcaacacgccggcacatgagctcggcgccgctgtcatcaagggcgtgctc
gagcgcgccggcgtcgaggcgggtgaggtcgatgaggtgatcctcggccaggtgctgcag
gccggcgagggccagaacccggcgcgccaggcggcgatcaaggccggcctcccgcaggaa
gcgaccgcctggggcatgaaccagctttgcggctcgggtcttcgcgccgtggcgctcggc
atgcagcagatcgcatccggcgatgcagacatcattattgccggcggcatggagtcgatg
tcgatggcgccgcattgcgcacacctgcgtggcggcgtgaagatgggcgacttcaagatg
atcgacacgatgatcaaggacggcctgaccgacgccttctacggctaccacatgggcatt
accgccgagaacgtcgcgcgccagtggcagctcagccgcgaggagcaggacaccttcgca
ctcgcctcgcagaacaaggcggaagcggcacagaaggcgggacgcttcgccgatgagatc
gttccgttcatcgtcaagacccgcaagggtgacgtcagcgtcgaccaggatgaatatatc
cgccatggcgccacgctcgaccagatgaccaagctgcgtccggccttcgacaagcaagga
accgtgaccgccggcaacgcatccggcctcaatgatggtgccgccgccaccctgttgatg
accgaggcgcaggcttccaagcgtggcatccagccgctcgcccgcatcatctcctgggca
accgccggcgtcgatccgcaggtcatgggcaccggcccgatcccggcttcgcgcaaggcg
ctggcgaaagccggctgggcgatcggcgatgtcgaactggtcgaagccaacgaggccttc
gccgctcaggcttgcgctgtcaacaaggacctcggctggaatcccgatatcgtcaacgtc
aacggtggcgccattgccatcggtcacccgatcggcgcatccggcgcccgcgtgctcaac
acgctgctcttcgaactgaaacgccgcggcgccaaaaagggattggcgacgctctgcatc
ggcggcggcatgggtgtcgccatgtgcgtggaagcgatgtga

DBGET integrated database retrieval system