KEGG   Rhizobium gallicum: RGR602_PC00488Help
Entry
RGR602_PC00488    CDS       T03539                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase GroES-like protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rga  Rhizobium gallicum
Pathway
rga00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RGR602_PC00488
Enzymes [BR:rga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     RGR602_PC00488
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     RGR602_PC00488
    1.1.1.-  
     RGR602_PC00488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AJD44528
UniProt: A0A0B4XD67
Position
pRgalR602c:524751..525764
Genome map
AA seq 337 aa AA seqDB search
MKAVRLHDTKVLRVEEVAEPSAPPPGFVNLLIRAAGICGSDLHNYRTGQWISRRPSTAGH
EFCGRVTAVGEGVSHVAVGDVVSADSRVSCGTCPACMSGRSNVCETLGFVGEVCDGGFAE
AVQLPARLVVRHDPQLSPHIAAMAEPLAVALHAVRRLAVPAGEPVLVIGCGTIGGLSALL
LRRLHDGPLLLADLNAERSALVSEVTGGTVVSLDKAKIEAALSGGRLRHALDATGSIQAI
ELALDIMSSGGALALVGIGHGKLDFDPNILVEREISLIGSHAFAGELPEAVGLLVELAPA
LQRFIMVLPALDDVPEAYEQLLRGESKALKTIVEVAG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtgcggctccacgataccaaggtcctgcgggtggaggaagtggccgagcca
tcggccccgccaccgggcttcgtcaatctcctgatcagggccgccggtatctgcggttcc
gaccttcacaactaccgcaccggtcagtggatctcgcgtcgtccctccacggccgggcat
gaattctgcggccgcgtgacggctgtcggagaaggcgtcagccatgttgcggttggggat
gtcgtctctgcggattcgcgcgtatcgtgcggcacctgcccagcctgtatgagcggccgc
agcaacgtctgcgagacgctgggcttcgtcggcgaggtctgcgacggcggctttgccgag
gcggtgcaactaccggcccggctggtcgtccgtcacgatccgcagctttcgccgcatatc
gccgccatggccgagccgctcgcagtagcgctgcacgccgtgcgccgtctcgccgtcccg
gccggggaaccggttctcgtgatcggttgcggcacgatcggcgggctgagcgcccttctt
ctccgccggctgcatgacggcccgctgctgctggccgatctcaatgctgaaaggtcggct
ctcgtttccgaggtgaccggcggcacggtcgtttctcttgacaaggcaaagatcgaagca
gcactttccggcggacggctgcgtcatgccctcgatgccaccggcagtatccaggcgatt
gaactggcgcttgacatcatgtcgagcggtggagcgcttgccctcgtcggtatcggccac
ggcaagctcgacttcgacccgaacatcctggtcgagcgggagatatcgctcatcggcagc
catgccttcgccggcgaactgcccgaggccgtcgggctgcttgtcgagctcgcgcccgcg
cttcaacgcttcatcatggtgctgccggctctcgacgacgtgcccgaggcttacgaacag
ctgttgcggggcgagagcaaggccctgaagacgatcgtcgaggtggcgggctag

DBGET integrated database retrieval system