KEGG   Rhizobium gallicum: RGR602_PC01281Help
Entry
RGR602_PC01281    CDS       T03539                                 

Definition
(GenBank) acetyl-CoA acetyltransferase protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rga  Rhizobium gallicum
Pathway
rga00071  Fatty acid degradation
rga00072  Synthesis and degradation of ketone bodies
rga00280  Valine, leucine and isoleucine degradation
rga00310  Lysine degradation
rga00362  Benzoate degradation
rga00380  Tryptophan metabolism
rga00620  Pyruvate metabolism
rga00630  Glyoxylate and dicarboxylate metabolism
rga00640  Propanoate metabolism
rga00650  Butanoate metabolism
rga00900  Terpenoid backbone biosynthesis
rga01100  Metabolic pathways
rga01110  Biosynthesis of secondary metabolites
rga01120  Microbial metabolism in diverse environments
rga01130  Biosynthesis of antibiotics
rga01200  Carbon metabolism
rga01212  Fatty acid metabolism
rga02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rga00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RGR602_PC01281
   00630 Glyoxylate and dicarboxylate metabolism
    RGR602_PC01281
   00640 Propanoate metabolism
    RGR602_PC01281
   00650 Butanoate metabolism
    RGR602_PC01281
  Lipid metabolism
   00071 Fatty acid degradation
    RGR602_PC01281
   00072 Synthesis and degradation of ketone bodies
    RGR602_PC01281
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RGR602_PC01281
   00310 Lysine degradation
    RGR602_PC01281
   00380 Tryptophan metabolism
    RGR602_PC01281
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RGR602_PC01281
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RGR602_PC01281
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RGR602_PC01281
Enzymes [BR:rga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RGR602_PC01281
Exosome [BR:rga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RGR602_PC01281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJD45308
UniProt: A0A0B4XF79
Position
pRgalR602c:1357423..1358610
Genome map
AA seq 395 aa AA seqDB search
MQLQDPVVIVGSARTPIGGFQGELKDATAPALGAAAIRAALERSRVEAGAVDEVVFGCVL
PAGQGQAPARQAAIGAGLAFSTGASTINKMCGSGMKATMIAHDLIAAGSASVTIAGGMES
MTNAPYLLDRARSGYRLGHGRVVDHLFLDGLEDAYDKGRLMGTFAEDCAEAYQFTRAEQD
SYAIASLTRAQKAIEAGYFDEEITPVTIKTGKSELTVAHDEQPGKAKLEKIPALKPAFRD
GGTVTAANSSSISDGAAALVLMRRSQAERRGLETLATITAHATHSQAPNLFATAPIGALE
KLSDRAGWSFDTVDLFEINEAFAVVAMAAMRDLHLPHDKVNVHGGACALGHPIGASGARI
IVTLLAALERYDLKRGMAALCIGGGEATAVALERH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgcaggatcctgtcgtgattgtcggctcggcacgcaccccgatcggcggattt
cagggcgagctcaaggatgctacggcgcccgcgcttggagctgccgcaatacgggccgca
cttgaacgcagccgcgtcgaggcgggggccgttgatgaagtggtgtttggctgcgtccta
ccggccggccagggccaggcgccggcgagacaggcggccatcggcgctggccttgccttt
tcgaccggcgccagcaccattaacaagatgtgcggctccggcatgaaagcgacgatgatt
gctcatgacctcattgccgctggaagtgcctcggtcaccatcgccggcgggatggaaagc
atgacgaatgcgccctatctcctggatcgggcacgtagcggctaccggctcggccacggg
cgcgttgtcgatcatctgttcctcgacgggcttgaggatgcttatgacaagggacgtttg
atgggcactttcgcggaagactgcgccgaggcctatcaattcacacgcgccgaacaggat
agctatgcgatcgcctcgctgacgcgggcgcaaaaggcgatcgaggccggctatttcgat
gaagagatcacaccggtgaccatcaagaccggcaaaagcgaactgacggttgcgcacgac
gaacagccgggcaaggcaaaacttgaaaagattccggcactgaagcctgccttccgcgac
ggcggaaccgtgaccgctgctaattcgagctcgatttccgatggtgcagcggcgctggtc
ctcatgcgccgctcccaggccgaacgccgcggattggagacgcttgccacgatcactgcc
cacgccacccattcgcaggcgcccaatctctttgcgaccgcgccgatcggtgctcttgag
aagctttccgatcgcgccggctggtcgtttgatacagtcgatcttttcgaaatcaacgag
gctttcgcggtcgtcgccatggctgcgatgcgcgatctccacctgccgcacgacaaggtc
aacgtgcatggcggtgcctgtgcgcttggccatccgatcggtgcatcgggagcacgtatc
attgtcacgctgcttgcggctcttgagcgatacgacctgaagcgcggcatggccgcactt
tgcatcggcggcggcgaggcaactgcggtcgccctcgaacggcactaa

DBGET integrated database retrieval system