KEGG   Rhizobium gallicum: RGR602_PC01555Help
Entry
RGR602_PC01555    CDS       T03539                                 

Definition
(GenBank) fructose-bisphosphate aldolase protein
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
rga  Rhizobium gallicum
Pathway
rga00010  Glycolysis / Gluconeogenesis
rga00030  Pentose phosphate pathway
rga00051  Fructose and mannose metabolism
rga00680  Methane metabolism
rga01100  Metabolic pathways
rga01110  Biosynthesis of secondary metabolites
rga01120  Microbial metabolism in diverse environments
rga01130  Biosynthesis of antibiotics
rga01200  Carbon metabolism
rga01230  Biosynthesis of amino acids
Module
rga_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGR602_PC01555
   00030 Pentose phosphate pathway
    RGR602_PC01555
   00051 Fructose and mannose metabolism
    RGR602_PC01555
  09102 Energy metabolism
   00680 Methane metabolism
    RGR602_PC01555
Enzymes [BR:rga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     RGR602_PC01555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AJD45581
UniProt: A0A0B4XEQ4
Position
pRgalR602c:complement(1651770..1652849)
Genome map
AA seq 359 aa AA seqDB search
MARIALRQLLDHAAEYGYGVPAFNINNMEQGLAVMEAAAACDAPVILQASKGARAYAKDI
MLARMIEALSEIYPAIPICVHQDHGSDEATCMTAIRHGFTSVMMDGSLEADAKTPSSYEY
NVAITERVTHIAHWLGVSVEGELGVLGSLESGTGAAEDGHGAEGALSHEQLLTDPDQAVD
FVARTGVDALAIACGTSHGAYKFTRAPDGDILAMGVIQAIHLKLPNTHLVMHGSSSVPQE
MQDVINRFGGRMPQTYGVPVEEIERGIRHGVRKVNIDTDCRMAMAGQFRKIAAEHPEEFD
PRKFLKPAMDALRNLCRDRFERFGTAGNASRIKVIALDEMARRYAAGELDPKTTAAKAA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcatcgcactacgccagctgctcgatcatgcagcggaatacggttatggagtt
cccgccttcaatatcaacaatatggagcaggggcttgcggttatggaggcggctgccgcc
tgtgacgctcccgttattctccaagcctccaagggtgcccgcgcctatgcaaaggacatt
atgctggcgcgcatgatcgaggcgctttcggaaatctatccggccatacccatctgcgtc
catcaggaccatggcagcgacgaagcgacctgcatgacggcgatacgccacggcttcacc
tcggtgatgatggatggctctctcgaagcggatgccaaaacaccttcgtcttatgagtat
aatgtcgcgatcaccgaacgggtcacgcacattgcccattggctgggcgtctcggtcgaa
ggggagctaggtgttctcggttcgctggagagcggtaccggcgctgccgaggacggtcat
ggcgctgaaggtgctctatcacatgagcagcttctgacggatcctgaccaggccgtcgat
ttcgtcgcgcgcaccggcgtcgatgcgctggcgatcgcctgcggcacgtctcatggcgcc
tacaagttcaccagggcgccggacggcgacattctggcaatgggcgtcatccaggcaatt
cacctcaagctgccgaacacgcatctcgtcatgcacggctcatcctcggtcccgcaggaa
atgcaggacgtcatcaaccgcttcggaggacgaatgccgcagacctacggcgtgcccgtc
gaggagatcgagcgcggcattcgccatggtgtccgcaaggtcaacatcgataccgactgt
cgcatggcgatggcggggcagtttcgcaagatcgccgctgagcatccggaggaattcgat
ccgcgaaaattcctgaaacctgcaatggatgccttgcgcaatctctgccgtgaccgcttc
gaacgtttcggcacggcgggcaacgcctcaaggatcaaggtcattgccttagatgagatg
gcgagacgctatgccgcgggcgaactcgatccgaaaaccacagcagccaaagccgcctga

DBGET integrated database retrieval system