KEGG   Rhizobium gallicum: RGR602_PC02274Help
Entry
RGR602_PC02274    CDS       T03539                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase GroES-like protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rga  Rhizobium gallicum
Pathway
rga00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RGR602_PC02274
Enzymes [BR:rga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     RGR602_PC02274
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     RGR602_PC02274
    1.1.1.-  
     RGR602_PC02274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AJD46293
UniProt: A0A0B4XI77
Position
pRgalR602c:2330974..2332044
Genome map
AA seq 356 aa AA seqDB search
MKAARFYAKGDVRVEDIDKPMALQPDEVLVRNKFCGICGTDLHEFADGPHFISDVPNAFS
GASIPAILGHELSGEIEAVGADVKHLRPGDRVAIQPHMGPADGYFGVRGLHFLGTRGAAT
GLTWNWGGFADYAVMKAYATVKMPDGLSYEQGAMVEPAAVAVTAIDRSGLEPGGAILITG
GGPIGALAVMAAHVAGAGKIVVSEPNATRRERIENLGITVVTVDPTAVSLGQFARDNTFE
GLGFDAAIECAGNPRAITDCIKAVRPQATVVLIGLTNAKVEFTPFDLITRDIRLQGSLCY
PTTLWPRIYSMIESGRLPVERLIDETISVDDIIEKGFQPLLDPSGIKMKILVQLNA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctcgtttctatgccaaaggcgatgtacgtgtcgaagatatcgacaagcca
atggcgctccaaccggacgaggtgctcgttcggaacaagttctgcggcatttgcggtacc
gacctgcatgagttcgccgatggcccacatttcatctcggacgtgccgaacgccttttcc
ggggcctccatcccggcgatcctggggcatgaactcagcggcgagatcgaagctgtcggc
gcagacgtcaaacacctgcgtcctggcgaccgtgttgcgatccagccccacatgggaccg
gccgacggatacttcggggtacgcggcctgcatttcctggggacgcggggcgctgccacc
ggcctgacctggaactggggtggctttgccgattatgcggtcatgaaggcctacgccacg
gtgaaaatgccggacgggctgagctacgaacagggtgcaatggtcgagcctgctgcggtt
gcggtgacggccatcgacagaagcggcctggagcctgggggggcgatcctgatcaccggc
ggcggcccgatcggcgccctcgccgtcatggcggcgcacgtcgctggcgccggcaagatc
gtcgtgagcgaacccaacgctacccggcgcgagcgcatcgagaaccttggtatcacggtc
gtcacggtggatcccaccgcagtttcgcttgggcagttcgcccgcgacaacacgttcgaa
ggcctcggcttcgatgccgccatcgagtgtgcaggcaatcctcgcgccataaccgattgc
atcaaggcggtccgcccgcaggcgacggtggtccttattgggctcacaaatgcgaaggtg
gagttcactccgttcgacctcatcacccgcgacattcgtctgcaggggtccctgtgttat
ccgacgacgctgtggccaaggatctactcgatgatcgagagcggacgcctgcctgtagag
cgcctgatcgacgaaacgatctccgtcgacgatatcatcgagaagggattccagcccctc
ctcgatccgtccggcatcaagatgaagatcctcgtgcaactgaacgcctag

DBGET integrated database retrieval system