KEGG   Rubrivivax gelatinosus: RGE_09950Help
Entry
RGE_09950         CDS       T01803                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase PhbA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00071  Fatty acid degradation
rge00072  Synthesis and degradation of ketone bodies
rge00280  Valine, leucine and isoleucine degradation
rge00310  Lysine degradation
rge00362  Benzoate degradation
rge00380  Tryptophan metabolism
rge00620  Pyruvate metabolism
rge00630  Glyoxylate and dicarboxylate metabolism
rge00640  Propanoate metabolism
rge00650  Butanoate metabolism
rge00900  Terpenoid backbone biosynthesis
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01120  Microbial metabolism in diverse environments
rge01130  Biosynthesis of antibiotics
rge01200  Carbon metabolism
rge01212  Fatty acid metabolism
rge02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RGE_09950 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    RGE_09950 (phbA)
   00640 Propanoate metabolism
    RGE_09950 (phbA)
   00650 Butanoate metabolism
    RGE_09950 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RGE_09950 (phbA)
   00072 Synthesis and degradation of ketone bodies
    RGE_09950 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RGE_09950 (phbA)
   00310 Lysine degradation
    RGE_09950 (phbA)
   00380 Tryptophan metabolism
    RGE_09950 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RGE_09950 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RGE_09950 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RGE_09950 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rge04147]
    RGE_09950 (phbA)
Enzymes [BR:rge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RGE_09950 (phbA)
Exosome [BR:rge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RGE_09950 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAL94336
UniProt: I0HMU9
Position
1038108..1039283
Genome map
AA seq 391 aa AA seqDB search
MTDIVIAAAARTAIGSFNGTLASLEAAELGTIAIRAALERAQLDAALIDEVILGQVLAAG
QSQNPARRAAVNAGIPQEATAFGLNQVCGSGLRAVALGAQQIACGDAKYIVAGGMESMSR
ARHVAHLRNGVKMGPLEFVDSMIYDALTDTFNGYHMGITAENIARQYGITREEQDTFAVG
SQNKAEAAQKAGRFAAEIVPVTIKSKKGDVVFDQDEFVRHGATLEALAKLRPAFEKTGTV
TAGNASGINDGAAAVVLMTAQEAEARGIRPLARIASWATAGVDPTVMGTGPIPASRKALA
KAGWTVGDLDLIEANEAFAVQAISVARELGFDPAKVNVNGGAIALGHPVGASGARVLTTL
LYEMQRREARKGLATLCIGGGMGVAMCLERA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcgtcattgccgccgccgcccgtacggccatcggctcgttcaacggcacg
ctcgcatcgctggaagcggccgaactcggcaccatcgccatccgcgccgcgctggagcgc
gcgcagctcgacgccgccctcatcgacgaggtgatcctcggccaggtcctggccgccggc
cagagccagaacccggcgcgccgcgccgccgtcaacgccggcatcccgcaggaagccacg
gccttcggcctgaaccaggtctgcggctccggcctgcgcgccgtcgcgctgggcgcgcag
cagatcgcctgcggcgacgccaagtacatcgtcgccggcggcatggagagcatgagccgc
gcccgccacgtcgcgcacctgcgcaacggcgtgaagatgggcccgctggagttcgtcgac
agcatgatctacgacgcgctgaccgacaccttcaacggctaccacatgggcatcacggcc
gagaacatcgcccgccagtacggcatcacgcgcgaggagcaggacacgttcgccgtgggc
tcgcagaacaaggccgaggcggcgcagaaggcgggccgcttcgccgccgagatcgtgccg
gtgacgatcaagtccaagaagggcgacgtcgtcttcgaccaggacgagttcgtgcgccac
ggcgcgacgctggaagcgctggccaagctgcgcccggccttcgagaagaccggcacggtg
accgccggcaacgcctcgggcatcaacgacggcgccgccgccgtggtgctgatgacggcc
caggaagccgaagcccgcggcatccgcccgctggcgcgcatcgcgtcctgggcgacggcc
ggtgtcgacccgacggtcatgggcaccggcccgatcccggcgtcgcgcaaggcgctggcc
aaggccggctggaccgtcggcgacctcgacctgatcgaagccaacgaagccttcgccgtg
caggccatctcggtcgcgcgcgaactcggcttcgacccggccaaggtcaacgtcaacggc
ggcgcgatcgcgctgggccacccggtcggcgcctcgggcgcgcgggtcctgaccacgctg
ctgtacgagatgcagcgccgcgaagcccgcaagggcctggcgacgctgtgcatcggcggc
ggcatgggcgtcgcgatgtgcctggaacgtgcctga

DBGET integrated database retrieval system