KEGG   Rubrivivax gelatinosus: RGE_18640Help
Entry
RGE_18640         CDS       T01803                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase AcsA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00010  Glycolysis / Gluconeogenesis
rge00620  Pyruvate metabolism
rge00640  Propanoate metabolism
rge00680  Methane metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01120  Microbial metabolism in diverse environments
rge01130  Biosynthesis of antibiotics
rge01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGE_18640 (acsA)
   00620 Pyruvate metabolism
    RGE_18640 (acsA)
   00640 Propanoate metabolism
    RGE_18640 (acsA)
  Energy metabolism
   00680 Methane metabolism
    RGE_18640 (acsA)
Enzymes [BR:rge01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RGE_18640 (acsA)
Lipid biosynthesis proteins [BR:rge01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RGE_18640 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAL95205
UniProt: I0HQB8
Position
1948831..1950813
Genome map
AA seq 660 aa AA seqDB search
MSSADAPTEYSLYPPPADAVARAHVSGQAAYDALCAEADTDYTGYWGRLARELIAWKTPF
TQVLDESNAPFFKWFADGTLNASYNCLDRNIERGLGDKTAIIFEADGGEVRRVSYKELLA
IVNKMANGLKSLGVKKGDRVIIYLSMGVEGVAAMQACARIGATHSVVFGGFSAQSLRDRI
EDTGAVAVITADQQQRGGKALPLKTIVDEAIALGGCGSVKHVLVHKRTGADIPFDASRDL
WLADLVADQSEVCEPEWVEAEHPLFLLYTSGSTGKPKGVQHSTGGYLLHAALTTKWTFDL
KEDDVFWCTADIGWVTGHTYITYGPLALGGTEIVFEGVPTFPDASRFWKMIQDHKVSIFY
TAPTAIRSLIKAAEANEAVHPKSFDLSSLRILGSVGEPINPAAWEWYHKHVGGGRCPIVD
TFWQTETGGHMITPLPGVTTLVPGSCTLPFPGIQAAVVDETGKDVPWGQGGILVVKKPWP
SMIRTIWGDPERFKKSYYPADFHGKYYLAGDGAIRDPKTGYFTITGRIDDVLNVSGHRMG
TMEIESALVSHTELVAEAAVVGRPDDTTGEAICAFVVLKRPRPTGDEAKKLANELRNWVA
KEIGPIAKPKDIRFGENLPKTRSGKIMRRLLRSIARGEAITQDTSTLENPAILDQLSQTN
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgccgacgctcccaccgagtactccctctacccgccgccggccgacgccgtc
gctcgcgcccacgtctccggccaggccgcctacgacgcgctgtgcgccgaggccgacacc
gactacacgggttactggggccgcctcgcgcgcgaactcatcgcctggaagacgccgttc
acgcaggtgctcgacgagtcgaacgcgccgttcttcaagtggttcgccgacggcacgctg
aacgcctcgtacaactgcctggaccgcaacatcgaacgcggcctgggcgacaagacggcg
atcatcttcgaggccgacggcggcgaggtgcgccgtgtcagctacaaggaactgctggcc
atcgtcaacaagatggccaacggcctgaagtcgctgggcgtgaagaagggcgaccgggtc
atcatctacctctcgatgggcgtcgagggcgtggccgcgatgcaggcctgcgcgcgcatc
ggcgcgacgcactcggtggtcttcggcggtttctcggcgcagtcgctgcgcgaccgcatc
gaggacaccggcgcggtggccgtcatcaccgccgaccagcagcagcgcggcggcaaggcg
ctgccgctgaagaccatcgtcgacgaggcgatcgcgctgggcggctgcggcagcgtcaag
cacgtgctggtgcacaagcgcaccggcgccgacatcccgttcgacgcctcgcgcgacctc
tggctggccgacctggtggccgatcagagcgaggtctgcgagcccgagtgggtcgaggcc
gaacacccgctgttcctgctctacaccagcggctcgaccggcaagcccaagggcgtgcag
cactcgactggcggctacctgctgcacgcggcgctgaccaccaagtggaccttcgacttg
aaggaagacgacgtcttctggtgcaccgccgacatcggctgggtcaccggccacacctac
atcacctacggcccgctggcgctgggcggcaccgagatcgtcttcgaaggcgtgccgacc
ttccccgacgccagccgcttctggaagatgatccaggaccacaaggtcagcatcttctac
accgcaccgacggcgatccgctcgctgatcaaggccgccgaggccaacgaggcggtgcat
ccgaagagcttcgacctgtcgtcgctgcgcatcctggggtcggtcggcgagccgatcaac
ccggcggcgtgggagtggtatcacaagcacgtcggcggtggccgctgcccgatcgtcgac
accttctggcagaccgagaccggcggccacatgatcacgccgctgccgggcgtgacgacg
ctggtgccgggctcgtgcacgctgccgttcccgggcatccaggcggccgtcgtcgacgag
accggcaaggacgtgccctggggccagggcggcatcctggtcgtcaagaagccgtggccg
agcatgatccgcacgatttggggcgacccggagcgcttcaagaagagctactacccggcc
gacttccacggcaagtactacctggcgggcgacggcgcgatccgcgacccgaagaccggc
tacttcacgatcaccggccgcatcgacgacgtgctcaacgtctcgggccaccgcatgggc
acgatggagatcgagtcggccctggtcagccacaccgagctggtggccgaggcggcggtc
gtcggccgcccggacgacaccaccggcgaggcgatctgcgccttcgtcgtgctgaagcgc
ccgcgcccgaccggcgacgaggccaagaagctggccaacgaactgcgcaactgggtggcc
aaggagatcggcccgattgccaagcccaaggacatccgcttcggcgagaacctgcccaag
acgcgctccggcaagatcatgcgccgcctgctgcgctcgatcgcgcgcggcgaggcgatc
acccaggacacctcgacgctggaaaacccggcaattctcgatcagttgtcgcagaccaac
tga

DBGET integrated database retrieval system