KEGG   Rubrivivax gelatinosus: RGE_25740Help
Entry
RGE_25740         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
rge  Rubrivivax gelatinosus
Pathway
rge03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rge00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RGE_25740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rge02044]
    RGE_25740
Secretion system [BR:rge02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RGE_25740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: BAL95913
UniProt: I0HSC6
Position
complement(2710561..2711100)
Genome map
AA seq 179 aa AA seqDB search
MKDIYVVFKNSDIKGETRDSKHAAEYGIEVGSFEHRIQQPKSAAASSSGGHTAERTEHGE
MIFTKEIDSASTKLWQASSAGTVYKDVDIYFYRAFGGQDKTQSGTKRVNYLKIQLKNVVV
SSVSTNIVSGTELPTEVFGLKYSAVQWTYNEAPLDGASAKNTNVQGMWNLKTNDVSFAG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacatctacgtcgttttcaagaattccgacatcaagggcgagacccgcgattcc
aagcatgccgcggagtacggcatcgaggtcggttcgttcgagcaccgaatccagcagccg
aagtcggctgccgcctcatcctcaggcggccacaccgcagaacgcaccgagcatggggag
atgatcttcacgaaggagatcgattccgccagcaccaagctctggcaagccagttcggcc
ggcaccgtctacaaggacgtggacatctacttctaccgtgccttcggcggccaagacaag
acgcagagcggcacgaagcgcgtgaactacctgaagatccagctcaagaacgtggtggtg
tcatcggtatccaccaacatcgtcagcggcaccgagctgccgaccgaggtctttggcctc
aagtactcggcggtgcaatggacctacaacgaggccccgctcgacggcgcctcggccaag
aacaccaacgtccaaggcatgtggaacctcaagaccaacgacgtttcgttcgcgggctga

DBGET integrated database retrieval system