KEGG   Rubrivivax gelatinosus: RGE_26200Help
Entry
RGE_26200         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hemerythrin
Motif
Other DBs
NCBI-ProteinID: BAL95959
UniProt: I0HSH2
Position
2762032..2762556
Genome map
AA seq 174 aa AA seqDB search
MAASSGTKARPARAPAPPVPPFEALDRTHARVIEVLGQFDRLLAHIDENGADEVARGSAA
EILEFFNGHARQHHSDEERFVFPQLLAKGDAELVQSIKRLQQDHGWLEEDWLELAPQIEA
IAEGYNWYDLVMLRHALPVFTALYYEHIGLEESLVYPAARRHHASLEEGAKSRG
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaagctctggaaccaaagcccgtcccgcccgcgccccggcgccgccggtcccc
cccttcgaagcgctcgaccgcacgcacgcccgcgtcatcgaggtgctgggccagttcgac
cgcctgctcgcgcacatcgacgaaaacggcgccgacgaggtggcacgcggcagcgccgcc
gagatcctcgagttcttcaacggccacgcccgccagcaccactccgacgaggagcgtttc
gtcttcccgcaactgctggccaagggcgacgccgagctggtgcagagcatcaagcgcctg
cagcaggatcacggctggctggaggaagactggctcgagctcgcgccgcagatcgaagcc
atcgccgagggctacaactggtacgacctggtgatgctgcgccacgcgctgccggtcttc
accgcgctctattacgagcacatcggcctggaggagtcgctggtctacccggccgcccga
cgccaccacgcctcgctggaggaaggggcgaagtcgcgcggctga

DBGET integrated database retrieval system