KEGG   Rubrivivax gelatinosus: RGE_26270Help
Entry
RGE_26270         CDS       T01803                                 

Gene name
potF
Definition
(GenBank) putrescine ABC transporter substrate-binding protein PotF
  KO
K11073  putrescine transport system substrate-binding protein
Organism
rge  Rubrivivax gelatinosus
Pathway
rge02010  ABC transporters
Module
rge_M00300  Putrescine transport system
Brite
KEGG Orthology (KO) [BR:rge00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RGE_26270 (potF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rge02000]
    RGE_26270 (potF)
Transporters [BR:rge02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter [MD:M00300] [OT]
    RGE_26270 (potF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_6 SBP_bac_1 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: BAL95966
UniProt: I0HSH9
Position
2769578..2770678
Genome map
AA seq 366 aa AA seqDB search
MNLKSVLAMAGLALACSTVFAQEEEKVLNIYNWSDYIAEDTIKNFEKETGIKVRYDNFDN
NEIVHAKLVAGKTGYDIVVPSSNWAKLQLEGGLLRKLDKSQIPNLKNLDPAVEAALAKMD
PGNQYMVDWLWGYTTVGINVDKVKAALGSTPMPDNVWDLVFKPEYISKLKSCGVSFLDSA
SEVVPAALHYLGKPSFSKTPSDYAAAGQVLKAVRPYITLFSSSGYINDMANGSICLALGW
SGDINIARQRAIDGKTGQKIEALIPKTGGLLFFDVMVIPADAPRPGNAQKFINYILRPEV
HASLSNKVFYANPNAESRKFVKPEVANNPTVFLSPSDMARMVPPDSLNNDLRRLMTRTFT
SFKTGM
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgaagtccgtcctggcgatggctggcctcgccctggcctgctcgaccgtgttc
gcccaggaagaagaaaaagtcctgaacatctacaactggtcggactacatcgccgaggac
acgatcaagaacttcgagaaggaaacggggatcaaggtccgctacgacaacttcgacaac
aacgagatcgtgcacgccaagctggtggcgggcaagacgggttacgacatcgtcgtgccc
tcgtcgaactgggccaagctgcagctcgaaggcgggctgctgcgcaagctggacaagtcg
cagatcccgaacctcaagaacctcgatcccgcggtcgaagcggcgctggccaagatggac
ccgggcaaccagtacatggtcgactggctctggggctacacgacggtcggcatcaacgtc
gacaaggtgaaggcggcgctgggctcgacgccgatgcccgacaacgtctgggacctggtc
ttcaagcccgaatacatctccaagctcaagagctgcggcgtcagtttcctggactcggcc
tcggaagtcgtgccggccgcgctgcactacctgggcaagccctcgttcagcaagacgccc
agcgactatgccgccgccggccaggtgctgaaggccgtgcgcccgtacatcacgctgttc
agctcgtcgggctacatcaacgacatggccaacggctcgatctgcctggcgctgggctgg
tcgggtgacatcaacatcgcgcgccagcgcgcgatcgacggcaagaccggtcagaagatc
gaggcgctgatcccgaagaccggcgggctgctgttcttcgacgtgatggtgattccggcg
gacgcaccgcgcccgggcaacgcgcagaagttcatcaactacatcctgcgcccggaagtg
cacgcgtcgctgagcaacaaggtcttctacgccaacccgaacgccgaatcgcgcaagttc
gtgaagcccgaagtggccaacaatccgaccgtcttcctgtcgccgtcggacatggcccgc
atggtcccgccggattcgctgaacaacgacctgcgccggctgatgacccgcaccttcacc
tccttcaaaaccggaatgtga

DBGET integrated database retrieval system