KEGG   Rubrivivax gelatinosus: RGE_26310Help
Entry
RGE_26310         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3138 BBP2 Pox_A_type_inc MDMPI_N Spc24 FapA
Motif
Other DBs
NCBI-ProteinID: BAL95970
UniProt: I0HSI3
Position
2773740..2775140
Genome map
AA seq 466 aa AA seqDB search
MKPVRLTALVLAIGAAFPAAAQSNEDLLKELRALRDRVTELEKKLAAQPAAAPAPQAGQW
GMTPEQAQELARIGTKTEALQDNFEAQGFKGLKITGQIDPTWIYNRRANDASFVLLNRED
GRYTYDNSYFGMAVLDILKETESGTIWHLTLAPERGTGALINGGSIIHEASVAIPLEDLQ
TRLWVGQIPDWTGYEITLPAGNKLVTHNLLFDFMAPTAYTGAVYMTTVGKWQLKGGLANV
NTARNSSGNKTPSLIFRADYAKGEFSGFGFSGLHGKLHNYATDDTDADGNAVFSDQGRNT
LATLLEADAYFVRGDLSLFGQLSYGQQKKAAIYRENGLRDARWWGLSTTAAYKLTPRMEG
VVRADYVYNRKNGGGLLGYSSDDGANGIGRGLALDADGNVVLAGDPSKGANRYALTVGAN
YRYDENTLFKLEYRYDGATQAVFEDLKDGGYSKNNHLLGASVVVSF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgtccgcctgaccgccctcgtgctcgcgatcggcgccgccttcccggcggcc
gcgcagagcaacgaagacctgctgaaggaactgcgcgcgctgcgcgaccgcgtcaccgag
ctggagaagaagctcgccgcgcagccggcggccgcgccggcgccgcaggccggccagtgg
ggcatgacgcccgagcaggcgcaggagctggcccgcatcggcaccaagaccgaggcgctg
caggacaacttcgaggcccagggcttcaagggcctgaagatcaccggccagatcgacccg
acctggatctacaaccgccgcgccaacgacgcgtccttcgtgctgctcaaccgcgaggac
ggccgctacacctacgacaactcgtacttcggcatggccgtgctcgacatcctgaaggag
accgagagcggcacgatctggcacctgacgctggcgcccgaacgcggcaccggcgcgctg
atcaacggcggctcgatcatccacgaagcctcggtcgcgatcccgctggaggacctgcag
acgcggctgtgggtcggccagatccccgactggaccggctacgagatcacgctgccggcg
ggcaacaagctggtcacgcacaacctgctgttcgacttcatggcgccgaccgcctacacc
ggcgcggtctacatgacgaccgtcggcaagtggcagctcaagggcggcctggccaacgtc
aacaccgcgcgcaacagctcgggcaacaagacgccgtcgcttatcttccgtgccgactac
gccaagggtgagttcagcggcttcggcttcagcggcctgcacggcaagctgcacaactac
gcgacggatgacacggacgccgacggcaatgcggtgttctccgatcaaggccgcaacacg
ctggccacgctgctcgaggccgacgcctatttcgtgcgcggcgacctgtcgctcttcggc
cagctcagctacggccagcagaagaaggccgcgatctacagagaaaacggattgcgcgac
gcacgctggtggggcctgtcgacgaccgccgcctacaagctgacgccgcgcatggaaggc
gtcgtgcgcgccgactacgtctacaaccgcaagaacggcggcggcctgctgggctacagc
agcgacgacggcgccaacggcatcggccgcggtctggcgctggatgccgacggcaacgtc
gtgctggcgggcgacccgtccaagggcgccaaccgctacgcgctgaccgtcggtgccaac
taccgctacgacgagaacacgctgttcaagctcgaataccgctacgacggcgcgacgcag
gcggtgttcgaggacctcaaggacggcggctacagcaagaacaaccacctgctcggtgcc
tcggtggtcgtcagcttctga

DBGET integrated database retrieval system