KEGG   Rubrivivax gelatinosus: RGE_26330Help
Entry
RGE_26330         CDS       T01803                                 

Gene name
glnA
Definition
(GenBank) glutamine synthetase GlnA
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00220  Arginine biosynthesis
rge00250  Alanine, aspartate and glutamate metabolism
rge00630  Glyoxylate and dicarboxylate metabolism
rge00910  Nitrogen metabolism
rge01100  Metabolic pathways
rge01120  Microbial metabolism in diverse environments
rge01230  Biosynthesis of amino acids
rge02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RGE_26330 (glnA)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    RGE_26330 (glnA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RGE_26330 (glnA)
   00220 Arginine biosynthesis
    RGE_26330 (glnA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RGE_26330 (glnA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rge04147]
    RGE_26330 (glnA)
Enzymes [BR:rge01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     RGE_26330 (glnA)
Exosome [BR:rge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RGE_26330 (glnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N_2 Gln-synt_N ACT
Motif
Other DBs
NCBI-ProteinID: BAL95972
UniProt: I0HSI5
Position
2776689..2777984
Genome map
AA seq 431 aa AA seqDB search
MKPLRERLEAAGVHTLLVQFTDVHGVAKGKLVPLAHLDEVLATGAGFAGPSIWGTALPRC
GPRSEYYARGDAATALPLPWWPGVARLVGNGVVAGEPFDACPRQVLRRARERLAAHGLTM
QTGIEPEFFLLKRDAAGRWLPADDADRLDKPSYDLKSLPRQHGFLHALSGALADAGLDVL
QIDHEDAQGQYEVNFAHDEALASCDHLMLFKLAAHALAEARGLVFSMMPKPFADQPGSGL
HFHVSLWRGAEPAAEVLPAFVAGVLAHAPALAALAAPTVNSYKRLTVGESLSGTTWAPAY
VAHGPNNRTALVRTLPGRFEWRLPDASANPYLATAALIAAGLDGLERGLVPPPAVDDDLF
ALDLGTIRARGIALLPQSLAEALDALAGDPVVLGALGPTLGPEFLRLKRAEWTEYARQVS
GWELERYAACF
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgctgcgcgagcggctcgaagccgccggcgtgcacacgctgctggtccagttc
accgacgtgcacggcgtcgccaagggcaagctggtgccgctggcgcacctggacgaggtg
ctggccaccggcgccgggttcgccgggccgtcgatctggggcacggcgctgccgcgctgc
ggcccgcgctcggagtactacgcgcgcggcgacgccgcgaccgccctgcccctgccctgg
tggccgggcgtcgcgcgcctggtcggcaacggcgtcgtcgccggcgaacccttcgacgcc
tgtccgcgccaggtgctgcgccgcgcgcgcgagcgcctggccgcgcacggcctgacgatg
cagaccggcatcgagcccgagttcttcctgctgaagcgcgacgccgccggccgctggctg
ccggccgacgacgccgaccgcctggacaaaccttcgtacgacctgaagtcgctgccgcgc
cagcatgggttcctgcatgcgctgtccggcgcgctggccgatgccgggctggacgtgctg
cagatcgaccacgaggacgcgcagggccagtacgaagtcaacttcgcccacgacgaggcg
ctggcgagctgcgaccacctgatgctgttcaagctggccgcgcacgcgctggccgaagcg
cgcgggctggtcttctcgatgatgcccaagcccttcgccgaccagccgggcagcgggctg
cacttccacgtctcgctgtggcgcggcgccgagccggcggccgaggtgctgccggccttc
gtcgccggcgtgctggcgcacgcgccggcgctggcggcactcgccgcgccgaccgtcaac
tcgtacaagcgcctgaccgtcggcgaatcgctgtcgggcacgacctgggcgccggcctac
gtcgcccacgggccgaacaaccgcaccgccctcgtgcgcaccctgcccggccgcttcgag
tggcggttgcccgacgccagcgccaacccgtacctggccaccgcggcgctgatcgccgcc
gggctcgacggcctcgaacgcggcctggtgccgccgcccgcggtcgacgacgacctgttc
gcgctcgacctggggacgatccgcgcgcgcggcatcgccctgctgccgcagtcgctggcc
gaggcgctggacgcgctggccggcgacccggtggtgctgggcgcgctcgggcccacgctg
ggtcccgagttcctgcgcctcaagcgcgccgaatggaccgagtacgcgcgccaggtcagc
ggctgggagctggagcgctacgccgcctgtttctga

DBGET integrated database retrieval system