KEGG   Rubrivivax gelatinosus: RGE_26370Help
Entry
RGE_26370         CDS       T01803                                 

Gene name
mtnA
Definition
(GenBank) putative translation initiation factor, aIF-2BI/5-methylthioribose-1-phosphate isomerase MtnA
  KO
K08963  methylthioribose-1-phosphate isomerase [EC:5.3.1.23]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00270  Cysteine and methionine metabolism
rge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RGE_26370 (mtnA)
Enzymes [BR:rge01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.23  S-methyl-5-thioribose-1-phosphate isomerase
     RGE_26370 (mtnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF-2B HAP2-GCS1
Motif
Other DBs
NCBI-ProteinID: BAL95976
UniProt: I0HSI9
Position
complement(2779875..2780966)
Genome map
AA seq 363 aa AA seqDB search
MKVDGTPLRTIRAVAGGEAVEIIDQRLLPHRLVIERVASADEMIVAIRDMWVRGAPLIGA
SAAYGVALLMNADAGDAALEAGCERIRAARPTAVNLAWAVDRMLSHLRPLPAAQRRAAAW
ALADAIAEEDVAVNRAIGEHGLALIEAIAARRPGPVKVLTHCNAGWLATVDWGSATAPIY
RAQERGIELHVWVDETRPRNQGASLTAWELGKAGVPHTLVADNAGGHLMQRGEVDLCIVG
CDRVTIRGDVCNKIGTYLKALAAHDNGVPFYVAMPTSTLDPKLADGVREIPIEERSAREV
THIAGLTAAGELAEVCLVPKGTTAANPAFDVTPARLVSGLVTEHGVFPADETALRALAAR
SAR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgacggaaccccgctgcgcaccatccgcgccgtcgccggcggcgaggcggtc
gagatcatcgaccagcgcctgctgccgcaccgcctggtcatcgaacgggtcgccagcgcc
gacgagatgatcgtcgctatccgcgacatgtgggtgcgtggtgcgccgctgatcggcgcc
agcgccgcctacggcgtcgcgctgctgatgaacgccgacgccggcgatgccgcgctcgaa
gccggctgcgagcgcatccgcgccgcgcgcccgaccgccgtcaacctggcatgggccgtc
gaccgcatgctgagccacctgcgcccgctgcccgcggcccagcgccgcgccgccgcctgg
gcgctggccgacgccatcgccgaggaggacgtggccgtcaaccgcgcgatcggcgagcac
ggcctggcgctgatcgaagccatcgccgcccgtcgccccggcccggtcaaggtgctgacg
cactgcaacgccggctggctggcgaccgtcgactggggcagcgcgacggcgccgatctac
cgcgcccaggagcgcggcatcgagctgcacgtctgggtcgacgagacccgtccgcgcaac
cagggcgccagcctcacggcctgggagctgggcaaggccggcgtgccgcacacgctggtc
gccgacaacgccggcggccacctgatgcagcgcggcgaggtcgatctgtgcatcgtcggc
tgcgaccgcgtcacgatccgcggcgacgtctgcaacaagatcggcacctacctgaaggcg
ctggccgcgcacgacaacggcgtgccgttctacgtcgcgatgccgacctcgacgctggac
ccgaagctcgccgacggcgtgcgcgagatcccgatcgaggagcgcagcgcacgcgaggtg
acgcacatcgccgggctgacggccgccggcgagctggccgaggtctgcctggtgcccaag
ggcacgacggcggcgaatccggctttcgacgtcaccccggcgcgcctggtcagcggtctg
gtcaccgaacacggcgtcttccccgccgacgagacggcgctgcgcgcgctggccgcccgg
agcgcacgatga

DBGET integrated database retrieval system