KEGG   Rubrivivax gelatinosus: RGE_26420Help
Entry
RGE_26420         CDS       T01803                                 

Definition
(GenBank) alkylhydroperoxidase AhpD family core domain protein
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD
Motif
Other DBs
NCBI-ProteinID: BAL95981
UniProt: I0HSJ4
Position
complement(2784924..2785286)
Genome map
AA seq 120 aa AA seqDB search
MIESYRELTASISASLAQLRADIPETTRGFSALAMAATKPGTLDKKTKELIAMALSVGAR
CDPCVGFHADALVKLGCTRAEFEEMLGLCVYMGGGPSLMYAAKALQAYEEFGGERAPAAA
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagtcctaccgcgaactcaccgcctccatctccgcgtcgctggcccagctgcgc
gccgacattcccgagacgacccgcggcttctccgcgctggcgatggcggccaccaagccc
ggcacgctggacaagaagaccaaggagctgatcgcgatggcgctgtcggtcggcgcacgc
tgcgatccctgcgtcggcttccacgccgacgcgctggtcaagctcggctgcacgcgcgcc
gagttcgaggagatgctgggcctgtgcgtctacatgggcggcgggccgtcgctgatgtac
gccgccaaggcgctgcaggcctacgaggagttcggcggcgaacgcgcaccggcggccgcc
tga

DBGET integrated database retrieval system