KEGG   Rubrivivax gelatinosus: RGE_26450Help
Entry
RGE_26450         CDS       T01803                                 

Definition
(GenBank) peptidase S9 family protein
  KO
K06889  uncharacterized protein
Organism
rge  Rubrivivax gelatinosus
Brite
KEGG Orthology (KO) [BR:rge00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    RGE_26450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S9 Abhydrolase_6 Hydrolase_4 Abhydrolase_1 UPF0227 PAF-AH_p_II AXE1 Peptidase_S15 DLH DUF2920 Abhydrolase_3
Motif
Other DBs
NCBI-ProteinID: BAL95984
UniProt: I0HSJ7
Position
2789206..2790048
Genome map
AA seq 280 aa AA seqDB search
MSTTEETITIDVDGERIAGTFVAPGTLIPGVLFAHGWGGSREQYLARAREIAALGCVCLA
FDLRGHAGTQAQQAKVSRETNLRDLVAAYDRLVAHGDVDPEAVCVVGSSYGGYLGTILTT
LRPVRWLALRAPALYLDDGWDTPKLQLHRDQDLKTYRRSVVPARDNRALRALQQFAGDVL
LVESENDQIIPRAVINSYQEAARRVKSMTMRCIAGADHGLSGEADQRAYTQLLLGWFKEM
LLGARRGAVQPAAADGAAPERPLPTKKALSAVAADARPAA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaactgaagagacgatcacgatcgacgtcgacggcgaacgcatcgccggcact
ttcgtcgcgccgggcacgctgatccccggcgtgctgttcgcgcacggctggggcggcagc
cgcgagcagtacctggcgcgggcgcgcgagatcgccgcgctgggctgcgtctgcctggct
ttcgatctgcgcggccacgccggcacccaggcgcagcaggccaaggtctcgcgcgagacc
aatttgcgcgacctggtggccgcctacgaccgcctcgtcgcccacggcgacgtcgacccg
gaggccgtctgcgtcgtcggcagcagctacggcggctacctgggcaccatcctgacgacg
ctgcgcccggtgcgctggctggcgctgcgcgcgccggcgctgtacctggacgacggctgg
gacacgcccaagctgcagctgcaccgcgaccaggacctgaagacctaccgccgcagcgtc
gtgccggcgcgcgacaaccgcgcgctgcgcgcgctgcagcagttcgccggcgacgtgctg
ctcgtcgagtccgagaacgaccagatcatcccgcgcgcggtgatcaacagctaccaggag
gcggcgcggcgggtgaagtcgatgacgatgcgctgcatcgccggtgccgaccacggcctc
tcgggcgaagccgaccagcgcgcctacacccagctgctgctgggctggttcaaggagatg
ctgctcggcgcgcgccgcggcgccgtgcaaccggccgcggccgacggcgccgcgcccgag
cgtccgttgccgacgaagaaggcgctcagcgctgtcgccgccgacgcgcggccagcagcg
tga

DBGET integrated database retrieval system