KEGG   Rubrivivax gelatinosus: RGE_26490Help
Entry
RGE_26490         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
  KO
K07290  AsmA family protein
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsmA AsmA_2
Motif
Other DBs
NCBI-ProteinID: BAL95988
UniProt: I0HSK1
Position
complement(2791717..2793651)
Genome map
AA seq 644 aa AA seqDB search
MAAFAGLLLAALLLCEALGWPFLRGPVERAAARATASPVRIEAPFRVRFVLSPHVQAARI
VVGAAHGLELPHFVDAREVRVDWLWSDIRRWRDGAPLRLEALRAHALDARLQRLADGRAS
WQLGQPAAPPAGDAALPRFGLLALDQGHVEIDDRLLALRATVDLSGSEGEGGRGIEARAR
GQYRGHALDLRAQTAAALPLLDESEQAPALPVRLEGRVGEVVLAFDGRAAALLTGRRLDG
ALRLKGPSLAAVGSPLGLALPATPPFELVGRLAHDAGVWHLVAERAAVGSSRLAGDFRYD
GTREPGRLSGQLGGERLALADLGPAVGAAGAPARPAPADAPPRRVLPQREFNLPQLRGMD
ADVQVAVGELDFGTEALAPVRQLRTRVRLDDAVLRLDALSGVIGGGRVEGWSALDARQTP
AHWSLDLSFERVDVARWIPALRRGGGGDDARQALLTGILEGRLVLAGRGRSTAQILGSAD
GDGRLMLRRGTVSHLLTEAAGLDLAQALGVLVRGDEPLPLRCARLEFGVRDGLVVPRVAV
IDNRDSTVLVDGRASLADETLALRAQVRPKDFSPLSLRTPVLIGGHFSRPEVGVQAGRLA
GRAAAAIVLGVLAAPVAALLPFVDPGSGEKSDPCTAQPKPAPGR
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtggcggccttcgccggtctgctgctggcggccttgctgctctgcgaagcgctgggctgg
cctttcctgcgcgggccggtcgagcgcgccgcggcgcgtgccaccgccagcccggtgcgc
atcgaagcgccgtttcgcgtgcgcttcgttttaagcccccacgtgcaggcggcgcgcatc
gtcgtcggcgccgcgcacggtctggagctgccgcatttcgtcgacgcgcgcgaggtgcgt
gtcgactggctctggtccgacatccgccgctggcgcgacggcgcgccgctgcggctggag
gcgctgcgggcgcatgcgctcgacgcccgcctgcagcgcctggccgacggccgcgccagc
tggcagctcggccagcccgccgcgccgccggcgggcgacgccgcgctgccgcggttcggg
ctgctggcgctcgaccagggccacgtcgagatcgacgaccggctgctggcgctgcgtgcg
acggtcgacctgagcggcagcgaaggcgagggcgggcgcggcatcgaggcccgtgcccgg
ggccagtaccgcggccatgcgctggacctgcgcgcgcagacggccgcagcgctgccgctg
ctcgacgagtccgagcaggcgccggcgctgccggtgcggctggaaggccgggtcggcgag
gtcgtgctggccttcgacggccgcgctgccgcgctgctgaccggccgtcggctcgatggc
gcgttgcgcctgaaagggccgtcgctggccgcggtcgggtcgccgctgggcctggcgctg
ccggcgacgccgccgttcgagctggtcggccggctggcgcacgacgccggcgtctggcat
ctggtggccgaacgcgcggccgtcggcagcagccggctggcgggcgacttccgctacgac
ggcacgcgtgaacccggccggctcagcggccagctggggggcgagcggctggcgctggcc
gacctggggccggcggtcggtgccgcaggcgcgccggcgcgtccggcgcccgccgatgcg
ccgccgcggcgcgtgctgccgcagcgcgagttcaacctgccgcagctgcgcggcatggac
gccgacgtccaggtcgccgtcggcgagctcgacttcggcaccgaggcgctggccccggtg
cgccagctgcgcacgcgcgtgcggctggacgacgcggtgctgcggctggatgcgctttcg
ggcgtcatcggcggcggccgggtcgaaggctggagcgcgctggacgcgcggcagacgccg
gcgcactggtcgctggacctgagtttcgagcgggtcgacgtcgcgcgctggatcccggca
ctgcgccgcggcggtggcggcgacgacgcacgccaggcgctgctaaccggcattctggaa
ggccggctggtgctcgccggccgtggccgttcgacggcgcagatcctcggcagcgccgac
ggcgacggccgtctgatgctgcgccgcggcaccgtctcgcacctcttgaccgaggccgcg
ggtctcgaccttgcgcaggcgctgggcgtgctggtgcgcggcgacgagccgctgccactg
cgctgcgctcggctggagttcggcgtgcgcgacgggctggtcgtgccgcgtgtggcggtc
atcgacaaccgcgacagcacggtgctggtcgacggccgcgccagtctggccgacgagacg
ctggcgttgcgcgcgcaggtgcggcccaaggacttctcgccgctgtcgctgcgcacgccg
gtgctgatcggcggccacttctcgcgtcctgaggtcggcgtgcaggccggccggctggcc
gggcgggcggcggcggcgatcgtgctcggcgtgctggcggcgccggtggcggcgctgctg
cccttcgtcgacccgggcagcggcgagaagtccgatccctgcacggcacaacccaagccg
gcgccgggccgctga

DBGET integrated database retrieval system