KEGG   Rubrivivax gelatinosus: RGE_26520Help
Entry
RGE_26520         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hemerythrin Inhibitor_I66
Motif
Other DBs
NCBI-ProteinID: BAL95991
UniProt: I0HSK4
Position
complement(2794479..2794997)
Genome map
AA seq 172 aa AA seqDB search
MEPDSPEADDAVVMLVAQHRRLEELLRRLTGAEAEDRRREALQEAGDELALHLLAEERVF
YPAVAGASTEDVLLESLEEHLALKRLVADLLVMDPADTTFGAKAHVLQEQCEHHHEEEEE
HLFPKVVLLLPQAHRLDLGREMLREQGRLRRDGAPREALRGQTDAAEPLRAD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtggaacccgactctcccgaagccgacgacgccgtcgtgatgctggtcgctcagcaccgt
cgcctcgaggaactgctgcgccgcctgaccggcgccgaagccgaagaccggcgccgcgag
gcgttgcaggaagccggcgacgaactcgcactgcacctgctcgccgaagagcgcgtgttc
tatccggccgtcgccggcgccagcaccgaggacgtgctgctggaatcgctggaagagcat
ctggcgctcaagcgcctggtcgccgacctgctggtgatggaccccgccgacacgaccttc
ggcgccaaggcccacgtgctgcaggagcagtgcgagcaccaccacgaggaagaggaagag
cacctgttcccgaaggtcgtgctgctgctgccgcaggcccaccgcctggatctggggcgc
gagatgctgcgcgagcagggccggctgcgccgcgacggcgccccgcgcgaggcgctgcgc
ggccagaccgacgcggcggagcccttgcgcgccgattga

DBGET integrated database retrieval system