KEGG   Rubrivivax gelatinosus: RGE_26540Help
Entry
RGE_26540         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAL95993
UniProt: I0HSK6
Position
2796216..2796344
Genome map
AA seq 42 aa AA seqDB search
MALLLVTMPAFGGDAGNLVLEELGDLPRLLVQGVATGTGLAV
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
gtggccctgctgctggtcacgatgccggcattcggcggcgatgccggcaacctggtgctc
gaggaactcggcgacctgccccgtctgctggtgcagggcgtcgccacgggtacgggcctt
gccgtctga

DBGET integrated database retrieval system