KEGG   Rubrivivax gelatinosus: RGE_26590Help
Entry
RGE_26590         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAL95998
UniProt: I0HSL1
Position
2798797..2799873
Genome map
AA seq 358 aa AA seqDB search
MTQHDDRYRQQGGSQDDRRQWEQSGRSEQQAGSGGSRSSAGSNYGDWRPESDTRGQMGGS
YGGHDEGGRYGQQDQYSSRGGQMGGSYGQGGPYGGQGGLYGSQSGMGAGGSRHEGSQGYG
QGYGQGSQGYGQGNQGYGQGNQGYGQGERYGSSSGMGGSQGGFGSSGYGAGGTRGDWGQS
GQQGGMGGMGGLGDWGSTQRHEDWGRSGTGSGGSWGQGQGQGGYAGQGGWNSGQGQGHDH
QFDPDYHQWRSEQMRTLDDDYRSWRQDRYKKFSDEFSQWRSGRNRGGTGSSSEQGSGSSG
SGMSGSGMSGSTGLSESSGSSALGSTGGSSGISGAGSLGGSSLESDSGSGKSAGSKTK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcacgacgatcgttaccggcagcaaggcggctcgcaggacgaccggcgccag
tgggagcagtcgggccggtcggaacagcaggccggcagcggcggctcgcgcagcagcgcg
ggcagcaactacggcgactggcgccccgagtccgacacgcgcggccagatgggcggcagc
tacggcggtcacgacgaaggcggccgctacggccagcaggaccagtacagctcgcgcggt
ggccagatgggcggctcgtacggccaaggcggcccctacggcggccagggcggcctctac
ggcagccagtccggcatgggtgcgggcggcagccgtcacgaaggcagccagggttacggc
caaggctacggccagggcagtcagggctatggccagggcaaccagggctatggccagggc
aaccagggctatggccagggcgaacgctatggttcgtcgtccggcatgggcggctcgcaa
ggcggcttcggcagcagcggctacggtgccggcggcacgcgcggcgactggggccagagc
ggccagcaaggcggcatgggcggcatgggtggcctcggcgactggggttcgacccagcgc
cacgaggactggggccgctcgggcacgggctccggcggctcgtggggccagggtcagggc
cagggcgggtacgccggccagggcggctggaactccggtcagggccagggccacgaccac
cagttcgaccccgactaccaccagtggcgcagcgagcagatgcgcacgctcgacgacgac
taccgcagctggcgtcaggaccgctacaagaagttctcggacgagttctcgcaatggcgc
agcggccgcaaccgcggcggcacgggctcgtcgtcggagcagggttcgggcagcagcggc
tcgggcatgtccggcagcggcatgtccggcagcaccggcctgtccgagtcttcgggcagc
agcgcgctcggcagcaccggcggcagctcgggcatcagcggcgcgggcagcctgggcggc
agctcgctcgagtccgactcgggcagcggcaagtcggccggcagcaagaccaagtga

DBGET integrated database retrieval system