KEGG   Rubrivivax gelatinosus: RGE_26600Help
Entry
RGE_26600         CDS       T01803                                 

Definition
(GenBank) putative N-acetyltransferase
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_9 Acetyltransf_1 Acetyltransf_7 FR47 Acetyltransf_CG Acetyltransf_10
Motif
Other DBs
NCBI-ProteinID: BAL95999
UniProt: I0HSL2
Position
complement(2799928..2800605)
Genome map
AA seq 225 aa AA seqDB search
MSSQPGGCRPPYRIRLETPADHDEVVRLTRQAFWNVHVPGCSEHYLVHRMRRHADVLPEL
ALVLELDGRLVGSILYTRARLVDGQGREKPVLSFGPLSILPEFQRRGLGKALVAESFARA
VALGHDVVVIFGNPANYVSLGFRSCVRHSIAVAPGVFPAALLVRELVPGALPRGDWLYRG
SPVYEFDAAEADAFDTGFDPMPRLARPSQEEFFILSRARVTPDGA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgagccaacccggaggctgccggccgccatatcgcatccgtctcgagacgccggcg
gatcacgacgaggtcgtgcggctgacgcgccaggcgttctggaacgtgcatgtgcccggc
tgcagcgaacactacctggtgcaccggatgcgccgtcatgccgacgtcttgcccgagctc
gcactggtgctcgaactcgatggccgcctcgtcggcagcatcctgtacacgcgcgcccgg
ctggtcgacgggcagggccgagagaagccggtgctgagcttcgggccgctgtcgatcctg
ccggagtttcagcggcgcgggctgggcaaggcgctggtcgccgagtccttcgcacgtgcc
gtggcactgggccacgacgtcgtcgtcattttcggcaacccggcgaactacgtgtcgctg
ggttttcgcagctgcgtgcgtcactcgatcgccgtcgcgccgggcgtcttccccgccgcg
ctgctggtacgtgaactggtccctggtgcgctgccgcgcggcgactggctgtaccgcggc
agcccggtctacgagttcgacgcggccgaggcggatgccttcgacaccggcttcgatccg
atgccgcggctggcgcggcccagccaggaagagttcttcatcctgagccgggcgagggtc
acgccggacggcgcatga

DBGET integrated database retrieval system