KEGG   Rubrivivax gelatinosus: RGE_26610Help
Entry
RGE_26610         CDS       T01803                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30 HTH_IclR HTH_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: BAL96000
UniProt: I0HSL3
Position
2800731..2801648
Genome map
AA seq 305 aa AA seqDB search
MDRFEAMRAFVRVVDSGSFTQAARQLGLHKATVSQQVMALEATLGVRLLTRSTRSVAPTA
EGLAYHHRACTILQQLDEAETELRQGGQAIQGHLRVDVPVAVGRLVLAPAMREFLDRHPG
LSVELGCSDRVVDLVGAGVDCALRGGELPDSGLAARRIGQLRFVLCAAPRYIDEHGLPQT
PEALAGHRQVGYLSGATGALRPLRLQREGRSVEVEVPARIVTTDSGAALSAALDGLGLVQ
LAEFVAAHHLASGALVRVLPGWQSPSLPIHWVTPTPRQRPARVQAFIDWAQALLVRRLGS
GLEPA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaccgattcgaagcgatgcgcgccttcgtgcgcgtggtcgacagcggcagcttcacc
caggccgcgcgccagctgggcctgcacaaggccaccgtcagccagcaggtgatggcgctg
gaggcgacgctgggcgtgcgcctgctgacgcgcagcacccgctcggtcgcgccgaccgcc
gaaggcctggcctaccaccaccgcgcctgcacgatcctgcagcagctcgacgaggccgag
accgagctgcgccagggcggccaggcgatccagggccatctgcgcgtggacgtgccggtg
gccgtcggccgcctggtgctggcgccggcgatgcgcgagttcctcgaccggcatccgggc
ctcagcgtcgaactcggctgcagcgaccgcgtcgtcgacctggtcggcgccggggtcgac
tgcgcactgcgcggcggcgagctgcccgactcggggctggccgcgcgccgcatcggccag
ctgcgtttcgtgctctgcgcggcgccacgctacatcgacgagcacggcctgccgcagacg
cccgaggcgctggccgggcaccggcaggtcggctacctgagcggcgccaccggcgcgctg
agaccgctgcgcctgcagcgcgaaggccgcagcgtcgaggtggaggtgccggcgcgcatc
gtcaccaccgacagcggcgccgcgctcagcgccgcgctcgacgggctgggcctggtgcag
ctggccgagttcgtcgccgcccaccacctcgccagcggcgcgctggtgcgcgtgctgccg
ggctggcagagcccgtcgctgccgatccactgggtgacgccgaccccgcgccagcgcccg
gcgcgcgtgcaggccttcatcgactgggcgcaggcgctgctggtgcggcggctgggaagc
gggctggagccggcctaa

DBGET integrated database retrieval system