KEGG   Rubrivivax gelatinosus: RGE_26630Help
Entry
RGE_26630         CDS       T01803                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_IclR HTH_20 HTH_24 TrmB HTH_5 HxlR DUF742 HTH_1 HTH_AsnC-type HTH_34 DprA_WH HTH_38 Sigma70_r4 Fe_dep_repress
Motif
Other DBs
NCBI-ProteinID: BAL96002
UniProt: I0HSL5
Position
complement(2803328..2803804)
Genome map
AA seq 158 aa AA seqDB search
MDSPTFARRLGLLYRELSLRAARRMEQGRDSLAPEAVELLLHLAQTGPATLAELARQLER
PQSTVSARVSMLEAGGLLSRQPDRQDPRRLQVWLSASGRRALAEAMELLDTACLAAAAAA
WDGERRRRLVDELDALLDAMPPLAAPAAVGQRAANDDG
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtggacagcccgaccttcgcccgccgcctgggcctgctgtaccgcgagctgtcgctgcgc
gccgcgcggcgcatggagcagggccgcgacagcctggcccccgaggccgtcgagctgctg
ctgcacctggcgcagaccggcccggcgacgctggccgaactggcgcgccagctcgagcgg
ccgcagtccaccgtcagcgcccgggtctcgatgctcgaagccggcggcctgctgtcgcgc
cagcccgaccggcaggacccgcggcggctgcaggtctggctcagcgcctcggggcggcgt
gcactggccgaggcgatggagctgctggacaccgcctgcctggccgcggcggccgcggcc
tgggacggcgaacggcgccggcgcctggtcgacgaactcgacgccttgctcgatgcgatg
ccgccgttggcggcgcccgctgcggtcggccagcgtgccgccaacgacgacggctga

DBGET integrated database retrieval system