KEGG   Rubrivivax gelatinosus: RGE_26670Help
Entry
RGE_26670         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAL96006
UniProt: I0HSL9
Position
complement(2811633..2815289)
Genome map
AA seq 1218 aa AA seqDB search
MAICYQFLPWVRRGLGVALDTVDHLGALPPHGRASIGIQLAGLPDGGNVAPLTVQLYGPG
DVVGLDTRLVVRTDPRPGTTNFEPNYLAIVEFDPPDLPWMLTPALANADDRLRPWLVLVV
LRRDRCGRPRLQGQAPLPQIRVPAEHLAEELPPLAESWSWAHAQVVSARAAGDVDGIRAD
LQGDPRSNVSRLVCPRRLAPDTDYVACVVPAFEPGRLRGLGQAGDSAPTELQPAWNPQAG
ADVVLPVYHHWEFSTGAQGDFESLARRLRSPKKWQNDPATSALLGRVGTSPMSVDALLDG
DAPAQLTTMEGALVPLGYVPGSPPAAEHAASLAAIVDTPAGQVDNPVEDEPDGSVRHQEV
KPPLYGAWHARRHAVTPADEPGWWLAGLNLNPRYRAAAGYGAEVVRRHQEDYVDACWDQV
GTIREAAQLLNFTRLAIEVQRALKARHFDPLPPERLLQLAGPALARIEAVLPSGAVAYRV
DGRTASLGGQVERSSLPAAMVDGALRRGLSPQRRTLRLAAMRGGVGVQTLPALATRYLGT
MAEATRKPAAFEVNAFLADGVAGTRLFDGVALPAADDARVELGARGLRVAPTAGRVRAAL
AAGAAARAVVERGGVPLPRVRAGQSRGVFTDVHVERFAALAGAASGLGPADLGFVAAQVE
ALGRRGVEGLLVEAQTQGSALQFSALRIDARSGSVRVDRPLLRFVGRGAPQPAGAAVQRA
ASGLALGSWPAADARAYGNLGLLASLPPNAFDLQGGNSGVRLGVSETLEITRLGEAPPER
GVVSVTLPPAIRQRGVLNAFAEATRGVQRAWREPFDATHLRVMPVDFPLAQAAQVLRART
RPELTLRARLQSQLSLAGAPVGGSSPYVAAFLPPTAAAARLRYAIGPLLDRVMAFPQLCE
PMYRALAEHDPEAFMPGIGQLPPDLIMLVQVNQYFIDAFMVGANHEMNRELLWRGFPTDL
RGTPFQRFWHRLGPGSEGRIEHLPDMAPIHLWGRQPLGERVDPNVTDPDRVALLIKGRLL
LRYPTAAVYAWRRVKNAGPEDSKLLKGADGRLPGAADVQTPVFSGFIAPDISFFGFDIDK
ADIADWCFVVEEPMGEPRFGFDVPVPPPDAGAAKIGARPRAALAWAREQFALGAAATPAF
QALRTAGLSPWKTLSWSQLKVDAGQHLSIGALAALSNPADRPFASFPGLSATPTAAEIAQ
ALLQEPFRAYWEGPDLAT
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atggccatctgctaccagttcctgccctgggtgcggcgcgggctcggcgtcgcgctcgac
accgtcgatcacctgggggcgctgccgcctcacggtcgcgcgagcatcggcatccagctc
gccgggttgccggacggcgggaacgtcgcgccgctcacggtccagctctacggcccgggc
gacgtcgtcggcctggacacgcggctcgtcgtgcgcaccgacccgcggccgggcacgacg
aacttcgagcccaactacctggcgatcgtcgagttcgacccgcccgacctgccgtggatg
ctgacgccggcgctggccaacgccgacgaccggctgcggccctggctggtgctggtcgtg
ctgcgccgcgaccgctgcggccggccgcgcctgcaaggccaggcgccgctgccgcagatc
cgcgtgccggccgaacacctcgccgaggaactgccgccgctggccgagtcctggtcctgg
gcgcatgcgcaggtggtcagcgcgcgagccgcgggcgacgtcgacggcatccgcgccgac
ctgcagggcgacccgcgttccaacgtttcgcgcctggtctgcccgcgccggctggcgccc
gacaccgactacgtcgcctgcgtcgtgccggcgttcgagcccggccggctgcgcgggctg
gggcaggccggcgactcggcgccgaccgagctgcagccggcctggaacccgcaggccggc
gccgacgtcgtgctgccggtctatcaccactgggagttttcgaccggcgcccagggcgac
ttcgagtcgctggcgcggcgactgcgcagcccgaagaagtggcagaacgacccggcgacg
agcgcgctgctgggccgcgtcggcacctcgccgatgagcgtcgacgcgctgctcgacggc
gacgcgccggcgcagctgacgacgatggaaggcgcgctggtgccgctgggctacgtgccg
ggctcgccgccggccgccgaacacgcagccagcctggcggcgatcgtcgacacgccggcc
gggcaggtcgacaaccccgtcgaggacgagcccgacggcagcgtgcgccatcaggaggtc
aagccgccgctgtacggcgcctggcacgcccgccgccatgcggtgacgccggccgacgag
cccggctggtggctggccgggctgaacctgaacccgcgttaccgcgccgccgccggctac
ggtgccgaagtcgtgcggcgtcaccaggaagactacgtcgacgcctgctgggaccaggtc
ggcacgatccgcgaggccgcgcagcttctgaacttcacgcgcctggcgatcgaggtgcag
cgcgcgctgaaggcgcgccacttcgacccgctgccgcccgagcggctgctgcagctggcc
ggcccggcgctggcgcgcatcgaggccgtgctgccttcgggcgcggtggcctaccgcgtc
gacggcaggacggcgtcgctcggcggccaggtcgaacgctccagcctgccggcggcgatg
gtcgacggcgcgctgcgccgcggcctgagcccgcagcggcgcacgctgcggctggcggcg
atgcgtggtggcgtgggcgtgcagacgctgccggcgctggccacgcgctacctcggcacg
atggccgaggcgacacgcaagccggccgctttcgaggtcaacgccttcctcgccgacggc
gtcgccggcacgcggctgttcgacggcgtcgcgctgccggccgccgacgacgcgcgcgtc
gaactcggcgcgcgtggcctgcgcgtcgcgccgaccgccggccgggtgcgtgcggcgctg
gccgccggtgctgcggcacgggccgtcgtcgagcgcggcggcgtgccgctgccgcgtgtg
cgcgccggccagtcgcgtggtgtcttcaccgacgtgcacgtcgaacgtttcgcggcgctg
gccggcgccgccagcggcctggggccggcggacctcggtttcgtcgccgcccaggtcgag
gcgctggggcggcgcggtgtcgaaggcctgctcgtcgaggcccagacccagggcagcgca
ctgcagttcagcgcgctgcgcatcgacgcgcgcagcggcagcgtgcgtgtcgaccggccg
ctgctgcgtttcgtcggccgcggcgcgccgcagccggccggcgcggcggtgcagcgcgcg
gcgagcggcctggcgctgggttcgtggccggcggccgacgcgcgcgcctacggcaacctc
ggcctgctggccagcctgccgcccaacgccttcgacctgcagggcggcaacagcggcgtg
cgcctgggcgtcagcgagacgctggagatcacgcggctgggcgaggcgccgcccgagcgc
ggcgtggtcagcgtcacgctgccgccggcgatccgccagcgcggcgtgctgaacgccttc
gccgaggccacacgcggtgtgcagcgcgcctggcgcgagcccttcgacgcgacgcacctg
cgtgtcatgccggtggactttccgctcgcccaggcggcgcaggtgctgcgtgcgcgcacc
cggcccgagctgacgctgcgcgcgcggctgcagtcgcagctgtcgctggccggcgcgccg
gtcggcggcagcagcccctacgtcgccgcgttcctgccgcccacggccgccgcggcccgg
ctgcgttacgcgatcgggccgctgctggaccgcgtcatggccttcccgcagctgtgcgag
ccgatgtaccgcgcgctcgccgagcacgacccggaagccttcatgcccggcatcggccag
ctgccgcccgacctgatcatgctggtgcaggtcaaccagtacttcatcgacgccttcatg
gtcggcgccaaccacgagatgaaccgcgagctgctgtggcgcggcttcccgaccgacctg
cgcggcacgccgttccagcgtttctggcaccggctggggccgggcagcgaaggccgcatc
gaacacctgcccgacatggcgccgatccacctctggggccgccagccgctgggcgaacgt
gtcgacccgaacgtcaccgaccccgaccgcgtggcgctgctgatcaagggccggctgctg
ctgcgctacccgacggccgcggtctatgcctggcgccgcgtgaagaacgccgggcccgag
gacagcaagctgctgaagggcgccgacggccgcctgcccggcgcggccgacgtgcagacg
ccggtgttctcgggtttcatcgccccggacatcagcttcttcggcttcgacatcgacaag
gccgacatagccgactggtgtttcgtcgtcgaggagccgatgggcgagccgcgtttcggc
ttcgacgtcccggtgccgccaccggatgccggcgcggcgaagatcggcgcccggccgcgc
gccgcgctcgcctgggcgcgcgagcagttcgcgctgggcgccgccgcgacgccggccttc
caggcgctgcgcacggcgggcctgagcccgtggaagacgctgtcgtggtcgcagctgaag
gtcgacgccggccagcacctttcgatcggcgcgctggccgccttgtccaacccggccgac
cggccgttcgcgtccttcccgggcctcagcgccaccccgaccgccgccgagatcgcccag
gccctgctgcaggagcccttccgcgcctactgggaaggcccggacctcgcgacctga

DBGET integrated database retrieval system