KEGG   Rubrivivax gelatinosus: RGE_26750Help
Entry
RGE_26750         CDS       T01803                                 

Definition
(GenBank) putative lytic transglycosylase
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT Sel1 Glucosaminidase
Motif
Other DBs
NCBI-ProteinID: BAL96014
UniProt: I0HSM7
Position
complement(2825477..2826520)
Genome map
AA seq 347 aa AA seqDB search
MKPRRHLPGARAARRGSAVLAASLFWLAAAHAQAVPDLSSLPRPETPPPERGPVVPAQVE
RWRAEAKAYEYGDGVPRDAVLAAQLYCRAARYGDAESQFNLAWMLTNARGIERDEAQAAH
LFAAAAEQGLPQAVNMAASLGTPLGPPPPCLRPPEQDPVTAAAKPAPAPRARPGLRAPAS
AFAALPPPANAPQPIVRFVDLVAPEYKLAPQLVLAVMATESGFDPGALSPKNAQGLMQLM
PDTAARFKVRKLSDPVENIRGGMAYLRWLLAYYQGDVLFTLAAYNAGEGAVDRYRGVPPY
AETRAYVRRILASLGGQRWHPYDASVTPPSPMLATLSAAAALPNRLR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcgccgccacctccccggagcgcgcgccgcccgccgcggcagcgccgtcctc
gccgccagcctgttctggctggccgccgcgcacgcgcaggcggtgcctgacctgtcctcc
ctgccacgccccgagacgccgccgcccgaacgcggccccgtcgtgccggcgcaggtggaa
cgctggcgcgccgaggccaaggcctacgagtacggcgacggcgtgccgcgcgacgccgtg
ctggcggcccagctctattgccgtgccgcgcgttacggcgacgccgaatcgcagttcaac
ctggcctggatgctgaccaacgcacgcggcatcgaacgcgacgaggcccaggccgcgcac
ctgttcgccgccgccgcggagcagggcctgccgcaggcggtcaacatggccgccagcctg
ggcacgccgctcgggccgccgccgccttgcctgcgcccgcccgagcaggacccggtcacc
gccgccgccaaacccgccccggcgccgcgcgcccggcccggcctgcgcgcgccggcctcg
gctttcgccgccttgccgccgcctgcgaacgcgccgcagcctatcgtgcgtttcgtcgac
ctcgtggcgcccgagtacaagctcgcgccgcagctggtgctggcggtgatggccaccgag
agcggcttcgaccccggcgcgctgtcgccgaagaacgcccagggcctgatgcagctgatg
cccgacaccgcggcgcgtttcaaggtgcgcaagctgtcggacccggtggagaacatccgc
ggcggcatggcctatctgcgctggctgctggcctattaccagggcgacgtgctgttcaca
ctggccgcctacaacgccggcgaaggcgcggtcgaccgctaccgcggcgtgccgccgtac
gccgagacacgcgcctacgtgcgccgcatcctggcctcgctgggcgggcagcgctggcat
ccgtacgacgccagcgtcacgccgccgtcgccgatgctggcgacgctgtcggccgccgcg
gcgctgccgaacaggctgcgctga

DBGET integrated database retrieval system